Property Summary

NCBI Gene PubMed Count 11
PubMed Score 12.97
PubTator Score 8.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 2.3e-02
atypical teratoid / rhabdoid tumor -1.200 1.1e-05
medulloblastoma, large-cell -1.400 1.0e-03
oligodendroglioma -1.100 4.5e-02
primary pancreatic ductal adenocarcinoma 1.126 3.2e-03

Protein-protein Interaction (1)

Gene RIF (6)

AA Sequence

MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQH      1 - 70
FYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSELRLYCDLLMQQVHTIQEFVHH     71 - 140
DENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAKFKPEMFQLHHPDPLVSPVSPSPVQMMKRSV    141 - 210
SHPGSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEE    211 - 280
SRLMAKKQSESEDTLPSFSS                                                      281 - 300
//

Text Mined References (14)

PMID Year Title