Property Summary

NCBI Gene PubMed Count 11
PubMed Score 12.97
PubTator Score 8.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.08283736666299E-5
medulloblastoma, large-cell 6234 9.97205991623441E-4
primary pancreatic ductal adenocarcinoma 1271 0.00319682610720639
astrocytic glioma 2241 0.0230080749388811
oligodendroglioma 2849 0.0454329073277267
Disease Target Count Z-score Confidence
Duchenne muscular dystrophy 602 3.804 1.9
Legionnaires' disease 20 3.707 1.9

Expression

  Differential Expression (5)

Gene

PDB

2KCJ   2MDX   3RCP  

  Ortholog (14)

Gene RIF (6)

PMID Text
24462251 Binding sites on Fapp1 protein for Arf1 and phosphatidylinositol-4-phosphate minimally overlap
21454700 Molecular basis of phosphatidylinositol 4-phosphate and ARF1 GTPase recognition by the FAPP1 pleckstrin homology (PH) domain.
21298564 We report the complete (1)H, (13)C and (15)N resonance assignments of the FAPP1-PH in its free state and those induced by PtdIns(4)P or detergent micelles.
20300118 The micelle-bound structure of the FAPP1 pleckstrin homology domain reveals how its prominent wedge independently tubulates Golgi membranes by leaflet penetration.
18187620 Knockdown of pleckstrin homology domain containing, family A, member 3 (PLEKHA3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
15107860 Data show that FAPP1 and 2 are essential components of a phosphatidylinositol 4-phosphate- and ADP-ribosylation factor-regulated machinery that controls generation of constitutive post-Golgi carriers.

AA Sequence

MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQH      1 - 70
FYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSELRLYCDLLMQQVHTIQEFVHH     71 - 140
DENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAKFKPEMFQLHHPDPLVSPVSPSPVQMMKRSV    141 - 210
SHPGSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEE    211 - 280
SRLMAKKQSESEDTLPSFSS                                                      281 - 300
//

Text Mined References (14)

PMID Year Title
24462251 2014 Interaction of Fapp1 with Arf1 and PI4P at a membrane surface: an example of coincidence detection.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21454700 2011 Molecular basis of phosphatidylinositol 4-phosphate and ARF1 GTPase recognition by the FAPP1 pleckstrin homology (PH) domain.
21298564 2011 Secondary structure and 1H, 13C, 15N resonance assignments of the Golgi-specific PH domain of FAPP1.
20300118 2010 Structural basis of wedging the Golgi membrane by FAPP pleckstrin homology domains.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16341674 2005 Transcriptome analysis of human gastric cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
More...