Property Summary

NCBI Gene PubMed Count 8
Grant Count 5
Funding $4,580,000
PubMed Score 4.72
PubTator Score 4.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
osteosarcoma 3.834 0.000
glioblastoma 1.100 0.001
group 3 medulloblastoma -1.200 0.048
medulloblastoma, large-cell -2.000 0.001
juvenile dermatomyositis 1.095 0.000
primary pancreatic ductal adenocarcinoma 1.679 0.002
tuberculosis -1.100 0.000
diabetes mellitus -1.600 0.011
Breast cancer -2.700 0.037
pediatric high grade glioma 1.300 0.001
pilocytic astrocytoma 1.600 0.000
primary Sjogren syndrome 1.500 0.008
aldosterone-producing adenoma -1.058 0.032
acute myeloid leukemia 1.300 0.016
ulcerative colitis 2.300 0.000
ovarian cancer -2.000 0.000
pancreatic cancer 1.500 0.003

Gene RIF (3)

PMID Text
23460911 This study identified TAPP2 as a novel regulator of malignant B cell migration.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19786618 These findings identify TAPP2 as a novel link between PI3K signaling and the cytoskeleton with potential relevance for leukemia progression.

AA Sequence

MPYVDRQNRICGFLDIEEHENSGKFLRRYFILDTQANCLLWYMDNPQNLAMGAGAVGALQLTYISKVSIA      1 - 70
TPKQKPKTPFCFVINALSQRYFLQANDQKDMKDWVEALNQASKITVPKGGGLPMTTEVLKSLAAPPALEK     71 - 140
KPQVAYKTEIIGGVVVHTPISQNGGDGQEGSEPGSHTILRRSQSYIPTSGCRASTGPPLIKSGYCVKQGN    141 - 210
VRKSWKRRFFALDDFTICYFKCEQDREPLRTIFLKDVLKTHECLVKSGDLLMRDNLFEIITSSRTFYVQA    211 - 280
DSPEDMHSWIKEIGAAVQALKCHPRETSFSRSISLTRPGSSSLSSGPNSILCRGRPPLEEKKALCKAPSV    281 - 350
ASSWQPWTPVPQAGEKLLPPGDTSEDSLFTPRPGEGAPPGVLPSSRIRHRSEPQHPKEKPFMFNLDDENI    351 - 420
RTSDV                                                                     421 - 425
//

Text Mined References (13)

PMID Year Title
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23460911 2013 The tandem PH domain-containing protein 2 (TAPP2) regulates chemokine-induced cytoskeletal reorganization and malignant B cell migration.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19786618 2009 TAPP2 links phosphoinositide 3-kinase signaling to B-cell adhesion through interaction with the cytoskeletal protein utrophin: expression of a novel cell adhesion-promoting complex in B-cell leukemia.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16421571 2006 DNA sequence and analysis of human chromosome 8.
More...