Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.55
PubTator Score 4.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute myeloid leukemia 1.300 1.6e-02
aldosterone-producing adenoma -1.058 3.2e-02
Astrocytoma, Pilocytic 1.100 1.8e-05
Breast cancer -2.700 3.7e-02
diabetes mellitus -1.600 1.1e-02
glioblastoma 1.100 1.3e-03
group 3 medulloblastoma -1.200 4.8e-02
juvenile dermatomyositis 1.095 4.1e-09
medulloblastoma, large-cell -2.000 1.4e-03
osteosarcoma 2.830 4.6e-06
ovarian cancer -1.600 9.2e-06
pancreatic cancer 1.500 2.8e-03
pediatric high grade glioma 1.300 5.5e-04
primary pancreatic ductal adenocarcinoma 1.679 2.4e-03
primary Sjogren syndrome 1.500 8.5e-03
tuberculosis -1.100 7.3e-06
ulcerative colitis 2.300 7.0e-07

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (3)

AA Sequence

MPYVDRQNRICGFLDIEEHENSGKFLRRYFILDTQANCLLWYMDNPQNLAMGAGAVGALQLTYISKVSIA      1 - 70
TPKQKPKTPFCFVINALSQRYFLQANDQKDMKDWVEALNQASKITVPKGGGLPMTTEVLKSLAAPPALEK     71 - 140
KPQVAYKTEIIGGVVVHTPISQNGGDGQEGSEPGSHTILRRSQSYIPTSGCRASTGPPLIKSGYCVKQGN    141 - 210
VRKSWKRRFFALDDFTICYFKCEQDREPLRTIFLKDVLKTHECLVKSGDLLMRDNLFEIITSSRTFYVQA    211 - 280
DSPEDMHSWIKEIGAAVQALKCHPRETSFSRSISLTRPGSSSLSSGPNSILCRGRPPLEEKKALCKAPSV    281 - 350
ASSWQPWTPVPQAGEKLLPPGDTSEDSLFTPRPGEGAPPGVLPSSRIRHRSEPQHPKEKPFMFNLDDENI    351 - 420
RTSDV                                                                     421 - 425
//

Text Mined References (13)

PMID Year Title