Property Summary

NCBI Gene PubMed Count 11
Grant Count 2
Funding $20,397.5
PubMed Score 5.94
PubTator Score 6.55

Knowledge Summary

Patent (496)

Expression

  Differential Expression (12)

Synonym

Accession Q9HB15
Symbols THIK2
THIK-2
K2p12.1

Gene

 Grant Application (2)

Gene RIF (4)

PMID Text
25148687 In cell and tissues co-expressing THIK1 and THIK2, heterodimeric channels may contribute to cell excitability.
24163367 The cytoplasmic amino-terminal region of THIK2 (Nt-THIK2) contains an arginine-rich motif (RRSRRR) that acts as a retention/retrieval signal.
18676988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18209473 THIK-1 and THIK-2 are abundantly expressed in the proximal and distal nephron of the mammalian kidney.

AA Sequence

MSSRSPRPPPRRSRRRLPRPSCCCCCCRRSHLNEDTGRFVLLAALIGLYLVAGATVFSALESPGEAEARA      1 - 70
RWGATLRNFSAAHGVAEPELRAFLRHYEAALAAGVRADALRPRWDFPGAFYFVGTVVSTIGFGMTTPATV     71 - 140
GGKAFLIAYGLFGCAGTILFFNLFLERIISLLAFIMRACRERQLRRSGLLPATFRRGSALSEADSLAGWK    141 - 210
PSVYHVLLILGLFAVLLSCCASAMYTSVEGWDYVDSLYFCFVTFSTIGFGDLVSSQHAAYRNQGLYRLGN    211 - 280
FLFILLGVCCIYSLFNVISILIKQVLNWMLRKLSCRCCARCCPAPGAPLARRNAITPGSRLRRRLAALGA    281 - 350
DPAARDSDAEGRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGFSGGVGALGIMN    351 - 420
NRLAETSASR                                                                421 - 430
//

Text Mined References (11)

PMID Year Title
25148687 2014 Tandem pore domain halothane-inhibited K+ channel subunits THIK1 and THIK2 assemble and form active channels.
24163367 2013 Silencing of the tandem pore domain halothane-inhibited K+ channel 2 (THIK2) relies on combined intracellular retention and low intrinsic activity at the plasma membrane.
19890347 2010 Genome-wide association study of generalized vitiligo in an isolated European founder population identifies SMOC2, in close proximity to IDDM8.
18676988 2008 A high-density association screen of 155 ion transport genes for involvement with common migraine.
18209473 2008 Cellular localization of THIK-1 (K(2P)13.1) and THIK-2 (K(2P)12.1) K channels in the mammalian kidney.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11263999 2001 Genomic and functional characteristics of novel human pancreatic 2P domain K(+) channels.
11256078 2001 Potassium leak channels and the KCNK family of two-P-domain subunits.
More...