Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.03
PubTator Score 6.55

Knowledge Summary

Patent (496)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -3.400 2.2e-08
astrocytic glioma -1.600 2.0e-03
Astrocytoma, Pilocytic -1.200 5.8e-04
atypical teratoid / rhabdoid tumor -2.800 1.1e-05
ependymoma -1.400 1.3e-02
glioblastoma -3.100 1.5e-12
group 3 medulloblastoma -3.200 1.4e-06
medulloblastoma, large-cell -2.100 5.6e-04
oligodendroglioma -1.200 7.5e-13
primitive neuroectodermal tumor -2.500 3.0e-05
progressive supranuclear palsy 1.300 1.7e-02
subependymal giant cell astrocytoma 2.745 6.4e-03

Gene RIF (4)

AA Sequence

MSSRSPRPPPRRSRRRLPRPSCCCCCCRRSHLNEDTGRFVLLAALIGLYLVAGATVFSALESPGEAEARA      1 - 70
RWGATLRNFSAAHGVAEPELRAFLRHYEAALAAGVRADALRPRWDFPGAFYFVGTVVSTIGFGMTTPATV     71 - 140
GGKAFLIAYGLFGCAGTILFFNLFLERIISLLAFIMRACRERQLRRSGLLPATFRRGSALSEADSLAGWK    141 - 210
PSVYHVLLILGLFAVLLSCCASAMYTSVEGWDYVDSLYFCFVTFSTIGFGDLVSSQHAAYRNQGLYRLGN    211 - 280
FLFILLGVCCIYSLFNVISILIKQVLNWMLRKLSCRCCARCCPAPGAPLARRNAITPGSRLRRRLAALGA    281 - 350
DPAARDSDAEGRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGFSGGVGALGIMN    351 - 420
NRLAETSASR                                                                421 - 430
//

Text Mined References (11)

PMID Year Title