Property Summary

NCBI Gene PubMed Count 12
Grant Count 4
R01 Count 4
Funding $254,773.16
PubMed Score 9.08
PubTator Score 7.02

Knowledge Summary

Patent (294)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Brain Ischemia 87 3.618 1.8

Expression

Gene RIF (4)

PMID Text
25148687 In cell and tissues co-expressing THIK1 and THIK2, heterodimeric channels may contribute to cell excitability.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18209473 THIK-1 and THIK-2 are abundantly expressed in the proximal and distal nephron of the mammalian kidney.
16683720 expression in cell hypoxia

AA Sequence

MAGRGFSWGPGHLNEDNARFLLLAALIVLYLLGGAAVFSALELAHERQAKQRWEERLANFSRGHNLSRDE      1 - 70
LRGFLRHYEEATRAGIRVDNVRPRWDFTGAFYFVGTVVSTIGFGMTTPATVGGKIFLIFYGLVGCSSTIL     71 - 140
FFNLFLERLITIIAYIMKSCHQRQLRRRGALPQESLKDAGQCEVDSLAGWKPSVYYVMLILCTASILISC    141 - 210
CASAMYTPIEGWSYFDSLYFCFVAFSTIGFGDLVSSQNAHYESQGLYRFANFVFILMGVCCIYSLFNVIS    211 - 280
ILIKQSLNWILRKMDSGCCPQCQRGLLRSRRNVVMPGSVRNRCNISIETDGVAESDTDGRRLSGEMISMK    281 - 350
DLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIMNNRLAETSGDR                351 - 408
//

Text Mined References (12)

PMID Year Title
25148687 2014 Tandem pore domain halothane-inhibited K+ channel subunits THIK1 and THIK2 assemble and form active channels.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
20400778 2010 Genomic variation associated with mortality among adults of European and African ancestry with heart failure: the cohorts for heart and aging research in genomic epidemiology consortium.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18516069 2008 Regulation of two-pore-domain (K2P) potassium leak channels by the tyrosine kinase inhibitor genistein.
18209473 2008 Cellular localization of THIK-1 (K(2P)13.1) and THIK-2 (K(2P)12.1) K channels in the mammalian kidney.
16683720 2006 Acute hypoxic regulation of recombinant THIK-1 stably expressed in HEK293 cells.
16382106 2005 International Union of Pharmacology. LV. Nomenclature and molecular relationships of two-P potassium channels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...