Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.08
PubTator Score 7.02

Knowledge Summary

Patent (294)

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Brain Ischemia 87 3.618 1.8

Expression

Synonym

Accession Q9HB14 B5TJL8 Q96E79
Symbols THIK1
THIK-1
K2p13.1

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA EggNOG
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG

Gene RIF (4)

PMID Text
25148687 In cell and tissues co-expressing THIK1 and THIK2, heterodimeric channels may contribute to cell excitability.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18209473 THIK-1 and THIK-2 are abundantly expressed in the proximal and distal nephron of the mammalian kidney.
16683720 expression in cell hypoxia

AA Sequence

MAGRGFSWGPGHLNEDNARFLLLAALIVLYLLGGAAVFSALELAHERQAKQRWEERLANFSRGHNLSRDE      1 - 70
LRGFLRHYEEATRAGIRVDNVRPRWDFTGAFYFVGTVVSTIGFGMTTPATVGGKIFLIFYGLVGCSSTIL     71 - 140
FFNLFLERLITIIAYIMKSCHQRQLRRRGALPQESLKDAGQCEVDSLAGWKPSVYYVMLILCTASILISC    141 - 210
CASAMYTPIEGWSYFDSLYFCFVAFSTIGFGDLVSSQNAHYESQGLYRFANFVFILMGVCCIYSLFNVIS    211 - 280
ILIKQSLNWILRKMDSGCCPQCQRGLLRSRRNVVMPGSVRNRCNISIETDGVAESDTDGRRLSGEMISMK    281 - 350
DLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIMNNRLAETSGDR                351 - 408
//

Text Mined References (12)

PMID Year Title
25148687 2014 Tandem pore domain halothane-inhibited K+ channel subunits THIK1 and THIK2 assemble and form active channels.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
20400778 2010 Genomic variation associated with mortality among adults of European and African ancestry with heart failure: the cohorts for heart and aging research in genomic epidemiology consortium.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18516069 2008 Regulation of two-pore-domain (K2P) potassium leak channels by the tyrosine kinase inhibitor genistein.
18209473 2008 Cellular localization of THIK-1 (K(2P)13.1) and THIK-2 (K(2P)12.1) K channels in the mammalian kidney.
16683720 2006 Acute hypoxic regulation of recombinant THIK-1 stably expressed in HEK293 cells.
16382106 2005 International Union of Pharmacology. LV. Nomenclature and molecular relationships of two-P potassium channels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...