Property Summary

NCBI Gene PubMed Count 13
PubMed Score 11.46
PubTator Score 7.02

Knowledge Summary

Patent (294)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Birk-Barel syndrome 8 6.627 3.3
Brain Ischemia 110 3.245 1.6

Expression

Gene RIF (5)

AA Sequence

MAGRGFSWGPGHLNEDNARFLLLAALIVLYLLGGAAVFSALELAHERQAKQRWEERLANFSRGHNLSRDE      1 - 70
LRGFLRHYEEATRAGIRVDNVRPRWDFTGAFYFVGTVVSTIGFGMTTPATVGGKIFLIFYGLVGCSSTIL     71 - 140
FFNLFLERLITIIAYIMKSCHQRQLRRRGALPQESLKDAGQCEVDSLAGWKPSVYYVMLILCTASILISC    141 - 210
CASAMYTPIEGWSYFDSLYFCFVAFSTIGFGDLVSSQNAHYESQGLYRFANFVFILMGVCCIYSLFNVIS    211 - 280
ILIKQSLNWILRKMDSGCCPQCQRGLLRSRRNVVMPGSVRNRCNISIETDGVAESDTDGRRLSGEMISMK    281 - 350
DLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIMNNRLAETSGDR                351 - 408
//

Text Mined References (13)

PMID Year Title