Property Summary

NCBI Gene PubMed Count 55
Grant Count 31
R01 Count 6
Funding $13,857,909.11
PubMed Score 39.54
PubTator Score 44.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.400 0.000
non-small cell lung cancer 1.100 0.000
invasive ductal carcinoma 1.200 0.003

Gene RIF (33)

PMID Text
26797417 Identify 50 novel BCL2L12 splice variants in human tumor cell lines.
26297542 miR-125a-5p inhibits cell proliferation and induces apoptosis in colon cancer cells via targeting BCL2, BCL2L12 and Mcl-1.
26260387 CD82 regulated BCL2L12 expression via STAT5A and AKT signaling and stimulated proliferation and engrafting of leukemia cells.
26082034 Results show that high Bcl2L12 mRNA expression was associated with the high-grade breast cancer and triple-negative (TNBC) subtype. Also, the interplay between Bcl2L12 and its variant may be associated with high lymph node metastasis in non-TNBC tumors.
25586056 Bcl2L12 retains a BH3-like domain, which is important for its anti-apoptotic property.
25230343 Data indicate that BCL2-like 12 (proline rich) protein BCL2L12 mRNA levels can distinguish women with breast cancer from healthy controls.
24339738 Bcl2L12 was previously shown to inhibit apoptosis through binding to caspase 7.
24078567 Acute myeloid leukemia patients have a lower level of BCL2L12 gene expression.
23901115 Protein made from F17F mutant BCL2L12 transcript bound p53, inhibited UV-induced apoptosis more efficiently than WT BCL2L12, and reduced endogenous p53 target gene transcription.
23790536 Data indicate that BCL2L12 expression levels were associated with poor disease-free survival of the high-grade TaT1 bladder cancer patients.
More...

AA Sequence

MGRPAGLFPPLCPFLGFRPEACWERHMQIERAPSVPPFLRWAGYRPGPVRRRGKVELIKFVRVQWRRPQV      1 - 70
EWRRRRWGPGPGASMAGSEELGLREDTLRVLAAFLRRGEAAGSPVPTPPRSPAQEEPTDFLSRLRRCLPC     71 - 140
SLGRGAAPSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAIL    141 - 210
RRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARL    211 - 280
ALAMELSRRVAGLGGTLAGLSVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD                    281 - 334
//

Text Mined References (63)

PMID Year Title
26797417 2016 Identification of novel alternative splice variants of the BCL2L12 gene in human cancer cells using next-generation sequencing methodology.
26297542 2015 miR-125a-5p inhibits cell proliferation and induces apoptosis in colon cancer via targeting BCL2, BCL2L12 and MCL1.
26260387 2015 The novel function of CD82 and its impact on BCL2L12 via AKT/STAT5 signal pathway in acute myelogenous leukemia cells.
26082034 2015 Differential roles of Bcl2L12 and its short variant in breast cancer lymph node metastasis.
25586056 2015 Bcl2L12 with a BH3-like domain in regulating apoptosis and TMZ-induced autophagy: a prospective combination of ABT-737 and TMZ for treating glioma.
25230343 2014 BCL2L12: a promising molecular prognostic biomarker in breast cancer.
24339738 2013 Estrogen receptor ? isoform 5 confers sensitivity of breast cancer cell lines to chemotherapeutic agent-induced apoptosis through interaction with Bcl2L12.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24078567 2013 [Expression of BCL2L12 gene in de novo acute myeloid leukemia and its clinical implications].
More...