Property Summary

NCBI Gene PubMed Count 57
PubMed Score 41.67
PubTator Score 44.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Cancer 2499 3.227 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 8.7e-07
invasive ductal carcinoma 1.200 3.2e-03
non-small cell lung cancer 1.100 1.8e-19

Gene RIF (35)

AA Sequence

MGRPAGLFPPLCPFLGFRPEACWERHMQIERAPSVPPFLRWAGYRPGPVRRRGKVELIKFVRVQWRRPQV      1 - 70
EWRRRRWGPGPGASMAGSEELGLREDTLRVLAAFLRRGEAAGSPVPTPPRSPAQEEPTDFLSRLRRCLPC     71 - 140
SLGRGAAPSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAIL    141 - 210
RRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARL    211 - 280
ALAMELSRRVAGLGGTLAGLSVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD                    281 - 334
//

Text Mined References (65)

PMID Year Title