Property Summary

NCBI Gene PubMed Count 9
PubMed Score 17.45
PubTator Score 3.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
Atopic dermatitis -2.600 0.016
psoriasis -3.400 0.000

Synonym

Accession Q9HB03 Q5VZL3 Q8N180
Symbols CIG30
CIG-30

Gene

PANTHER Protein Class (2)

AA Sequence

MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILW      1 - 70
SFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKRP     71 - 140
LIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAIMYTYYTLKAANVKPPKMLPMLITSLQILQM    141 - 210
FVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKSQ              211 - 270
//

Text Mined References (10)

PMID Year Title
20937905 2010 ELOVL1 production of C24 acyl-CoAs is linked to C24 sphingolipid synthesis.
17583696 2007 ELOVL2 overexpression enhances triacylglycerol synthesis in 3T3-L1 and F442A cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14581464 2004 Role for ELOVL3 and fatty acid chain length in development of hair and skin function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10970790 2000 Cloning of a human cDNA encoding a novel enzyme involved in the elongation of long-chain polyunsaturated fatty acids.
10429212 1999 N-tail translocation in a eukaryotic polytopic membrane protein: synergy between neighboring transmembrane segments.
8944226 1996 Biosynthesis of triacylglycerols.