Property Summary

Ligand Count 6
NCBI Gene PubMed Count 9
PubMed Score 18.81
PubTator Score 3.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 4.2e-14
Atopic dermatitis 952 1.6e-02
Disease Target Count Z-score Confidence
Simpson-Golabi-Behmel syndrome 19 3.03 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
Atopic dermatitis -2.600 1.6e-02
psoriasis -2.700 4.2e-14

AA Sequence

MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILW      1 - 70
SFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKRP     71 - 140
LIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAIMYTYYTLKAANVKPPKMLPMLITSLQILQM    141 - 210
FVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKSQ              211 - 270
//

Text Mined References (10)

PMID Year Title