Property Summary

NCBI Gene PubMed Count 51
Grant Count 67
R01 Count 33
Funding $12,581,391.71
PubMed Score 197.83
PubTator Score 96.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -2.175 0.013
group 4 medulloblastoma -2.400 0.000
medulloblastoma, large-cell -2.700 0.001
non-small cell lung cancer -1.680 0.000
atypical teratoid/rhabdoid tumor 1.600 0.008
pilocytic astrocytoma -1.300 0.012
posterior fossa group A ependymoma -1.900 0.000
lung adenocarcinoma -1.400 0.002

Synonym

Accession Q9HAZ2 A6NHQ8 B1AJP7 B1AJP8 B1AJP9 B1WB48 Q8WYJ9 Q9C0I8
Symbols MEL1
KMT8F
LVNC8
PFM13
CMD1LL

Gene

PDB

2N1I  

Gene RIF (35)

PMID Text
26701852 High PRDM16 expression is associated with astrocytoma.
26684393 Results show that PRDM16 overexpression was highly recurrent in de novo paediatric AML and is associated with adverse outcome
26559765 Our results suggest that K568 SUMOylation of sPRDM16 plays an important role in the progression of acute myeloid leukemia.
25662275 PRDM16 might contribute to maintain adipose tissue "white fat" gene expression profile and systemic metabolic homeostasis.
25644605 MED1 is required for optimal PRDM16-induced Ucp1 expression
25567132 EVI1 and MEL1 are homolog genes whose transcriptional activations by chromosomal translocations have roles in Japanese pediatric acute myeloid leukemia
25035420 Three novel loci were identified in East Asians with cardiac arrhythmias: rs2483280 (PRDM16 locus) and rs335206 (PRDM6 locus) were associated with QRS duration; and rs17026156 (SLC8A1 locus) correlated with PR interval.
24966940 PRDM2, PRDM5, PRDM16 promoters are methylated and their expression is suppressed in lung cancer cells.
24863034 Genetic analyses uncovered the importance of the PRDM16 gene in the regulation of lean body mass.
24717670 Mutations in gene encoding the transcriptional co-activator PRDM16 may be a cause of left-ventricular noncompaction and dilated cardiomyopathy.
More...

AA Sequence

MRSKARARKLAKSDGDVVNNMYEPNRDLLASHSAEDEAEDSAMSPIPVGPPSPFPTSEDFTPKEGSPYEA      1 - 70
PVYIPEDIPIPADFELRESSIPGAGLGVWAKRKMEAGERLGPCVVVPRAAAKETDFGWEQILTDVEVSPQ     71 - 140
EGCITKISEDLGSEKFCVDANQAGAGSWLKYIRVACSCDDQNLTMCQISEQIYYKVIKDIEPGEELLVHV    141 - 210
KEGVYPLGTVPPGLDEEPTFRCDECDELFQSKLDLRRHKKYTCGSVGAALYEGLAEELKPEGLGGGSGQA    211 - 280
HECKDCERMFPNKYSLEQHMVIHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCVKVFTDPS    281 - 350
NLQRHIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSTVKPFICEVCHKSYTQFSNLCRHKRMHADCR    351 - 420
TQIKCKDCGQMFSTTSSLNKHRRFCEGKNHYTPGGIFAPGLPLTPSPMMDKAKPSPSLNHASLGFNEYFP    421 - 490
SRPHPGSLPFSTAPPTFPALTPGFPGIFPPSLYPRPPLLPPTSLLKSPLNHTQDAKLPSPLGNPALPLVS    491 - 560
AVSNSSQGTTAAAGPEEKFESRLEDSCVEKLKTRSSDMSDGSDFEDVNTTTGTDLDTTTGTGSDLDSDVD    561 - 630
SDPDKDKGKGKSAEGQPKFGGGLAPPGAPNSVAEVPVFYSQHSFFPPPDEQLLTATGAAGDSIKAIASIA    631 - 700
EKYFGPGFMGMQEKKLGSLPYHSAFPFQFLPNFPHSLYPFTDRALAHNLLVKAEPKSPRDALKVGGPSAE    701 - 770
CPFDLTTKPKDVKPILPMPKGPSAPASGEEQPLDLSIGSRARASQNGGGREPRKNHVYGERKLGAGEGLP    771 - 840
QVCPARMPQQPPLHYAKPSPFFMDPIYSRVEKRKVTDPVGALKEKYLRPSPLLFHPQMSAIETMTEKLES    841 - 910
FAAMKADSGSSLQPLPHHPFNFRSPPPTLSDPILRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYR    911 - 980
CKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKHEHENAPVSQHPGVLTNHLGT    981 - 1050
SASSPTSESDNHALLDEKEDSYFSEIRNFIANSEMNQASTRTEKRADMQIVDGSAQCPGLASEKQEDVEE   1051 - 1120
EDDDDLEEDDEDSLAGKSQDDTVSPAPEPQAAYEDEEDEEPAASLAVGFDHTRRCAEDHEGGLLALEPMP   1121 - 1190
TFGKGLDLRRAAEEAFEVKDVLNSTLDSEALKHTLCRQAKNQAYAMMLSLSEDTPLHTPSQGSLDAWLKV   1191 - 1260
TGATSESGAFHPINHL                                                         1261 - 1276
//

Text Mined References (53)

PMID Year Title
27151440 2016 PRDM16 Suppresses MLL1r Leukemia via Intrinsic Histone Methyltransferase Activity.
26701852 2016 miR-101 reverses hypomethylation of the PRDM16 promoter to disrupt mitochondrial function in astrocytoma cells.
26684393 2016 High PRDM16 expression identifies a prognostic subgroup of pediatric acute myeloid leukaemia correlated to FLT3-ITD, KMT2A-PTD, and NUP98-NSD1: the results of the Japanese Paediatric Leukaemia/Lymphoma Study Group AML-05 trial.
26559765 2015 SUMOylation of sPRDM16 promotes the progression of acute myeloid leukemia.
25662275 2015 PRDM16 sustains white fat gene expression profile in human adipocytes in direct relation with insulin action.
25644605 2015 PRDM16 enhances nuclear receptor-dependent transcription of the brown fat-specific Ucp1 gene through interactions with Mediator subunit MED1.
25578880 2015 Cold-inducible Zfp516 activates UCP1 transcription to promote browning of white fat and development of brown fat.
25567132 2015 High expression of EVI1 and MEL1 is a compelling poor prognostic marker of pediatric AML.
25085501 2014 Integrated genome-wide association, coexpression network, and expression single nucleotide polymorphism analysis identifies novel pathway in allergic rhinitis.
25035420 2014 Identification of three novel genetic variations associated with electrocardiographic traits (QRS duration and PR interval) in East Asians.
More...