Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.33
PubTator Score 7.23

Knowledge Summary

Patent (1,703)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.60799077252996E-9
osteosarcoma 7933 1.63332800866106E-8
psoriasis 6685 6.15500893376108E-8
tuberculosis 1563 6.17572436781084E-7
Breast cancer 3099 5.07515301886934E-6
cystic fibrosis 1670 1.53582878881925E-4
Pick disease 1893 2.58476026320728E-4
medulloblastoma, large-cell 6234 0.00160247725604142
invasive ductal carcinoma 2950 0.00251087339340637
Multiple myeloma 1328 0.00372960923926633
pituitary cancer 1972 0.00805407398159812

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.100 0.004
osteosarcoma -3.814 0.000
cystic fibrosis -1.300 0.000
medulloblastoma, large-cell -1.700 0.002
tuberculosis -1.400 0.000
non-small cell lung cancer -1.142 0.000
psoriasis 1.400 0.000
Pick disease -1.100 0.000
Breast cancer -1.200 0.000
invasive ductal carcinoma -1.100 0.003
ovarian cancer -2.600 0.000
pituitary cancer 1.200 0.008

Synonym

Accession Q9HAZ1
Symbols

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

MLP Assay (13)

AID Type Active / Inconclusive / Inactive Description
1770 confirmatory 332 / 226 / 794 qHTS Assay for Inhibitors of CDC-like Kinase 4 (Kinase-Glo Assay)
1771 confirmatory 356 / 249 / 747 qHTS Assay for Inhibitors of CDC-like Kinase 4 (ADP-Glo Assay)
1795 confirmatory 178 / 179 / 995 qHTS Assay for Inhibitors of CDC-like Kinase 4 (ADP-FP Assay)
1969 confirmatory 57 / 5 / 1 Confirmaiton Assay for Inhibitors of CDC-like Kinase 4 (ADP-Glo Assay)
1970 confirmatory 158 / 10 / 1 Confirmation Assay for Inhibitors of CDC-like Kinase 4 (Kinase-Glo Assay)
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
1983 confirmatory 46 / 14 / 3 Confirmation Assay for Inhibitors of CDC-like Kinase 4 (ADP-FP Assay)
1997 summary 29 / 0 / 0 qHTS for Inhibitors of CDC-like Kinase 4: Summary
2710 other 28 / 0 / 0 Kinase Inhibition Profile Study on Inhibitors of CDC-like Kinase 4
493204 confirmatory 83 / 3 / 2 Confirmation Assay for Inhibitors of CDC-like Kinase 4 (Kinase-Glo Assay): SAR round 2
More...

Gene RIF (2)

PMID Text
27126587 Clk1, Clk2 and Clk4 prevent chromatin breakage by regulating the Aurora B-dependent abscission checkpoint.
19168442 Cdc2-like kinases and DNA topoisomerase I regulate alternative splicing of tissue factor in human endothelial cells.

AA Sequence

MRHSKRTHCPDWDSRESWGHESYRGSHKRKRRSHSSTQENRHCKPHHQFKESDCHYLEARSLNERDYRDR      1 - 70
RYVDEYRNDYCEGYVPRHYHRDIESGYRIHCSKSSVRSRRSSPKRKRNRHCSSHQSRSKSHRRKRSRSIE     71 - 140
DDEEGHLICQSGDVLRARYEIVDTLGEGAFGKVVECIDHGMDGMHVAVKIVKNVGRYREAARSEIQVLEH    141 - 210
LNSTDPNSVFRCVQMLEWFDHHGHVCIVFELLGLSTYDFIKENSFLPFQIDHIRQMAYQICQSINFLHHN    211 - 280
KLTHTDLKPENILFVKSDYVVKYNSKMKRDERTLKNTDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVIL    281 - 350
ALGWSQPCDVWSIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPQHMIQKTRKRKYFHHNQLDWDEH    351 - 420
SSAGRYVRRRCKPLKEFMLCHDEEHEKLFDLVRRMLEYDPTQRITLDEALQHPFFDLLKKK             421 - 481
//

Text Mined References (15)

PMID Year Title
27126587 2016 Clks 1, 2 and 4 prevent chromatin breakage by regulating the Aurora B-dependent abscission checkpoint.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19168442 2009 Cdc2-like kinases and DNA topoisomerase I regulate alternative splicing of tissue factor in human endothelial cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
More...