Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.33
PubTator Score 7.23

Knowledge Summary

Patent (1,703)

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.100 0.004
osteosarcoma -3.814 0.000
cystic fibrosis -1.300 0.000
medulloblastoma, large-cell -1.700 0.002
tuberculosis -1.400 0.000
non-small cell lung cancer -1.142 0.000
psoriasis 1.400 0.000
Pick disease -1.100 0.000
Breast cancer -1.200 0.000
invasive ductal carcinoma -1.100 0.003
ovarian cancer -2.600 0.000
pituitary cancer 1.200 0.008

MLP Assay (13)

AID Type Active / Inconclusive / Inactive Description
1770 confirmatory 332 / 226 / 794 qHTS Assay for Inhibitors of CDC-like Kinase 4 (Kinase-Glo Assay)
1771 confirmatory 356 / 249 / 747 qHTS Assay for Inhibitors of CDC-like Kinase 4 (ADP-Glo Assay)
1795 confirmatory 178 / 179 / 995 qHTS Assay for Inhibitors of CDC-like Kinase 4 (ADP-FP Assay)
1969 confirmatory 57 / 5 / 1 Confirmaiton Assay for Inhibitors of CDC-like Kinase 4 (ADP-Glo Assay)
1970 confirmatory 158 / 10 / 1 Confirmation Assay for Inhibitors of CDC-like Kinase 4 (Kinase-Glo Assay)
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
1983 confirmatory 46 / 14 / 3 Confirmation Assay for Inhibitors of CDC-like Kinase 4 (ADP-FP Assay)
1997 summary 29 / 0 / 0 qHTS for Inhibitors of CDC-like Kinase 4: Summary
2710 other 28 / 0 / 0 Kinase Inhibition Profile Study on Inhibitors of CDC-like Kinase 4
493204 confirmatory 83 / 3 / 2 Confirmation Assay for Inhibitors of CDC-like Kinase 4 (Kinase-Glo Assay): SAR round 2
More...

Gene RIF (2)

PMID Text
27126587 Clk1, Clk2 and Clk4 prevent chromatin breakage by regulating the Aurora B-dependent abscission checkpoint.
19168442 Cdc2-like kinases and DNA topoisomerase I regulate alternative splicing of tissue factor in human endothelial cells.

AA Sequence

MRHSKRTHCPDWDSRESWGHESYRGSHKRKRRSHSSTQENRHCKPHHQFKESDCHYLEARSLNERDYRDR      1 - 70
RYVDEYRNDYCEGYVPRHYHRDIESGYRIHCSKSSVRSRRSSPKRKRNRHCSSHQSRSKSHRRKRSRSIE     71 - 140
DDEEGHLICQSGDVLRARYEIVDTLGEGAFGKVVECIDHGMDGMHVAVKIVKNVGRYREAARSEIQVLEH    141 - 210
LNSTDPNSVFRCVQMLEWFDHHGHVCIVFELLGLSTYDFIKENSFLPFQIDHIRQMAYQICQSINFLHHN    211 - 280
KLTHTDLKPENILFVKSDYVVKYNSKMKRDERTLKNTDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVIL    281 - 350
ALGWSQPCDVWSIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPQHMIQKTRKRKYFHHNQLDWDEH    351 - 420
SSAGRYVRRRCKPLKEFMLCHDEEHEKLFDLVRRMLEYDPTQRITLDEALQHPFFDLLKKK             421 - 481
//

Text Mined References (15)

PMID Year Title
27126587 2016 Clks 1, 2 and 4 prevent chromatin breakage by regulating the Aurora B-dependent abscission checkpoint.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19168442 2009 Cdc2-like kinases and DNA topoisomerase I regulate alternative splicing of tissue factor in human endothelial cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
More...