Property Summary

NCBI Gene PubMed Count 33
Grant Count 73
R01 Count 44
Funding $13,720,412.31
PubMed Score 273.85
PubTator Score 44.68

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9HAY6 A0AV48 A0AV50 Q9NVH5
Symbols BCO
BCDO
BCMO
BCDO1
BCMO1

Gene

PANTHER Protein Class (2)

Gene RIF (26)

PMID Text
25445224 This study indicates that the competitive actions of HNF-1alpha and HNF-4alpha on their overlapping binding sites in the human BCMO1 gene promoter oppositely regulate BCMO1 gene expression in the human small intestine.
25270992 Data suggest that beta-cryptoxanthin is a poorer substrate for BCMO1 than is beta-carotene; however, the comparatively high bioavailability of beta-cryptoxanthin from foods makes beta-cryptoxanthin-rich fruits good sources of vitamin A. [REVIEW]
24668807 Together with the data from (18)O-retinal-H2(16)O and (16)O-retinal-H2(18)O incubations to account for nonenzymatic oxygen exchange, our results show that BCO1 incorporates only oxygen from O2 into retinal. Thus, BCO1 is a dioxygenase.
24668807 Incubation of beta-carotene and recombinant human BCMO1 in either H2(18)O-(16)O2 or H2(16)O-(18)O2 medium yields two retinal products both of which contain oxygen atoms originating solely from O2 gas. The results show that BCMO1 is a dioxygenase and not a monooxygenase as previously thought.
24586510 Specific BCMO1 SNPs should be determined when assessing the effects of carotenoid supplementation on macular pigment and that their expression may be influenced by retinal disease.
24187135 Substrate specificity of purified recombinant human beta-carotene 15,15'-oxygenase (BCO1).
24106281 a stepwise cleavage by BCO2 and BCO1 with APO10ol as an intermediate could provide a mechanism to tailor asymmetric carotenoids such as beta-cryptoxanthin for vitamin A production.
24071514 CMO1 is expressed in human alveolar epithelial (A549) cells and converts beta-carotene into retinal and biologically active retinoic acids.
23803888 Inhibition of BCMO1 expression is associated with increased invasiveness of colon cancer cells and increased expression of MMP7 and MMP28. beta-Carotene can upregulate BCMO1 and reverse these effects.
23727499 Purified BCMO1 is a monomeric enzymatically active soluble protein that does not require cofactors and displays a turnover rate of about 8 molecules of beta,beta-carotene per second.
More...

AA Sequence

MDIIFGRNRKEQLEPVRAKVTGKIPAWLQGTLLRNGPGMHTVGESRYNHWFDGLALLHSFTIRDGEVYYR      1 - 70
SKYLRSDTYNTNIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDFTDNCLINIMKCGEDFYATSE     71 - 140
TNYIRKINPQTLETLEKVDYRKYVAVNLATSHPHYDEAGNVLNMGTSIVEKGKTKYVIFKIPATVPEGKK    141 - 210
QGKSPWKHTEVFCSIPSRSLLSPSYYHSFGVTENYVIFLEQPFRLDILKMATAYIRRMSWASCLAFHREE    211 - 280
KTYIHIIDQRTRQPVQTKFYTDAMVVFHHVNAYEEDGCIVFDVIAYEDNSLYQLFYLANLNQDFKENSRL    281 - 350
TSVPTLRRFAVPLHVDKNAEVGTNLIKVASTTATALKEEDGQVYCQPEFLYEGLELPRVNYAHNGKQYRY    351 - 420
VFATGVQWSPIPTKIIKYDILTKSSLKWREDDCWPAEPLFVPAPGAKDEDDGVILSAIVSTDPQKLPFLL    421 - 490
ILDAKSFTELARASVDVDMHMDLHGLFITDMDWDTKKQAASEEQRDRASDCHGAPLT                 491 - 547
//

Text Mined References (33)

PMID Year Title
25445224 2014 Competitive regulation of human intestinal ?-carotene 15,15'-monooxygenase 1 (BCMO1) gene expression by hepatocyte nuclear factor (HNF)-1? and HNF-4?.
25270992 2015 Beta-cryptoxanthin as a source of vitamin A.
24668807 2014 The human enzyme that converts dietary provitamin A carotenoids to vitamin A is a dioxygenase.
24586510 2014 The relationship between BCMO1 gene variants and macular pigment optical density in persons with and without age-related macular degeneration.
24187135 2013 Substrate specificity of purified recombinant human ?-carotene 15,15'-oxygenase (BCO1).
24106281 2013 Two carotenoid oxygenases contribute to mammalian provitamin A metabolism.
24071514 2013 ?-carotene regulates expression of ?-carotene 15,15'-monoxygenase in human alveolar epithelial cells.
23803888 2013 ?,?-carotene 15,15'-monooxygenase and its substrate ?-carotene modulate migration and invasion in colorectal carcinoma cells.
23727499 2013 Characterization of human ?,?-carotene-15,15'-monooxygenase (BCMO1) as a soluble monomeric enzyme.
23656756 2013 Single nucleotide polymorphisms in CETP, SLC46A1, SLC19A1, CD36, BCMO1, APOA5, and ABCA1 are significant predictors of plasma HDL in healthy adults.
More...