Property Summary

NCBI Gene PubMed Count 68
PubMed Score 43.92
PubTator Score 62.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Gene RIF (30)

AA Sequence

MARTGWTSPIPLCVSLLLTCGFAEAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMPEVSWQLGKSL      1 - 70
NCTVKTYSTSYTLEDLDREFMDFADAQWKAQVRSLFSLFLSSSNGFFNLFFSHCRSLFNDRKLVEYLKES     71 - 140
SFDAVFLDPFDACGLIVAKYFSLPSVVFARGIACHYLEEGAQCPAPLSYVPRILLGFSDAMTFKERVRNH    141 - 210
IMHLEEHLFCQYFSKNALEIASEILQTPVTAYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQG    211 - 280
KPLPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVK    281 - 350
WLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL    351 - 420
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIG    421 - 490
FLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH                                  491 - 530
//

Text Mined References (74)

PMID Year Title