Property Summary

NCBI Gene PubMed Count 72
Grant Count 8
R01 Count 8
Funding $996,804.27
PubMed Score 47.05
PubTator Score 67.92

Knowledge Summary

Patent

No data available

Gene RIF (33)

PMID Text
26220143 In further studies with UGT1A10, mutant F93G exhibited increased glucuronidation rates of 16alpha-hydroxyestrone, but not estrone
25547628 UGT1A10 exhibited somewhat higher BPA glucuronidation activity than UGT1A9, but it was lower than UGT2A1 and UGT2B15. 4.
25264962 A graphene nanocage with regulatable space for the assembly of a CYP1A2-UGT1A10 bienzyme complex has been constructed via a click reaction, and used to study drug sequential metabolism using an electrochemically-driven method.
24239897 DNA hypermethylation results in defective expression of UGT1A10 in the liver.
23160818 Suggest that extrahepatic UGT1A10 plays an important role in the metabolism and the bioactivation of the antitumor agent C-1305.
22659092 Triazoloacridinone and imidazoacridinone antitumor agents C-1305 and C-1311 are glucuronidated in human liver and intestine.
22031623 Data suggest that darexaban glucuronidation in jejunum microsomes is mainly catalyzed by UGT1A10; studies include kinetics of recombinant UGT proteins, liver microsomes, and jejunal microsomes (and UGT isoform-specific inhibitors/substrates).
21846474 role of Phenylalanine 93 in UGT1A10
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MARAGWTSPVPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMPEVSWQLERSL      1 - 70
NCTVKTYSTSYTLEDQNREFMVFAHAQWKAQAQSIFSLLMSSSSGFLDLFFSHCRSLFNDRKLVEYLKES     71 - 140
SFDAVFLDPFDTCGLIVAKYFSLPSVVFTRGIFCHHLEEGAQCPAPLSYVPNDLLGFSDAMTFKERVWNH    141 - 210
IVHLEDHLFCQYLFRNALEIASEILQTPVTAYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQG    211 - 280
KPLPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVK    281 - 350
WLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL    351 - 420
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIG    421 - 490
FLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH                                  491 - 530
//

Text Mined References (75)

PMID Year Title
26220143 2015 Glucuronidation of estrone and 16?-hydroxyestrone by human UGT enzymes: The key roles of UGT1A10 and UGT2B7.
25547628 2015 Differences in the glucuronidation of bisphenols F and S between two homologous human UGT enzymes, 1A9 and 1A10.
25264962 2014 Electrochemically driven drug metabolism via a CYP1A2-UGT1A10 bienzyme confined in a graphene nano-cage.
25246029 2015 Genome-wide analysis of hepatic lipid content in extreme obesity.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
24239897 2014 Epigenetic regulation of the tissue-specific expression of human UDP-glucuronosyltransferase (UGT) 1A10.
24163127 2014 Genome-wide association study identifies multiple loci associated with bladder cancer risk.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23642732 2013 Association of SNPs in the UGT1A gene cluster with total bilirubin and mortality in the Diabetes Heart Study.
More...