Property Summary

NCBI Gene PubMed Count 97
PubMed Score 74.60
PubTator Score 110.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
psoriasis 6694 4.1e-157
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Anemia 365 0.0 3.0
Attention deficit hyperactivity disorder 278 0.0 1.1
Disease Target Count Z-score Confidence
Bilirubin metabolic disorder 41 3.732 1.9
Pericholangitis 8 3.324 1.7
Cancer 2499 3.28 1.6
Disease Target Count
Sickle Cell Anemia 53

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 4.000 4.1e-157

Gene RIF (84)

AA Sequence

MARAGWTGLLPLYVCLLLTCGFAKAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMPEVSWQLGRSL      1 - 70
NCTVKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSNCRSLFNDRKLVEYLKES     71 - 140
CFDAVFLDPFDACGLIVAKYFSLPSVVFARGIFCHYLEEGAQCPAPLSYVPRLLLGFSDAMTFKERVWNH    141 - 210
IMHLEEHLFCPYFFKNVLEIASEILQTPVTAYDLYSHTSIWLLRTDFVLEYPKPVMPNMIFIGGINCHQG    211 - 280
KPVPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVK    281 - 350
WLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL    351 - 420
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIG    421 - 490
FLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH                                  491 - 530
//

Text Mined References (100)

PMID Year Title