Property Summary

NCBI Gene PubMed Count 97
Grant Count 7
R01 Count 7
Funding $345,300.94
PubMed Score 71.30
PubTator Score 110.22

Knowledge Summary

Patent

No data available

Synonym

Accession Q9HAW7 B8K293 O00473 UDPGT 1-7
Symbols UDPGT
UGT1G
UGT-1G
UGT1.7
UGT1-07
UDPGT 1-7

Gene

PANTHER Protein Class (2)

Gene RIF (84)

PMID Text
25743847 Increased UGT1A7 expression is associated with pancreatic cancer.
24453052 The rate of Results show that UGT1A7*12 allele frequency was not significantly different between the Uzbek and Japanese populations.
24255116 Results suggest that CYP3A4 changes the catalytic function of the UGT1A subfamily in a UGT isoform-specific manner.
23789755 The presence of UGT1A1*28, UGT1A7*3, UGT1A9*22 genotypes decreases SN-38 clearance between 20 and 36%
22901212 Polymorphism in UDP-glucuronosyltransferase 1A7 is associated with colorectal cancer.
22402308 the UGT1A7*3 allele is a risk factor for cancer among Asians, especially for hepatocellular carcinoma (Meta-Analysis)
22085268 there is a cancer risk associated with UGT1A7*3, Intermediate, and Low activity UGT1A7 genotypes, which is most evident in Asian individuals.
21440586 UGT1A7 variants play a relevant role for pancreas diseases
20860988 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MARAGWTGLLPLYVCLLLTCGFAKAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMPEVSWQLGRSL      1 - 70
NCTVKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSNCRSLFNDRKLVEYLKES     71 - 140
CFDAVFLDPFDACGLIVAKYFSLPSVVFARGIFCHYLEEGAQCPAPLSYVPRLLLGFSDAMTFKERVWNH    141 - 210
IMHLEEHLFCPYFFKNVLEIASEILQTPVTAYDLYSHTSIWLLRTDFVLEYPKPVMPNMIFIGGINCHQG    211 - 280
KPVPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVK    281 - 350
WLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL    351 - 420
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIG    421 - 490
FLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH                                  491 - 530
//

Text Mined References (100)

PMID Year Title
25743847 2015 Increased UGT1A3 and UGT1A7 expression is associated with pancreatic cancer.
25246029 2015 Genome-wide analysis of hepatic lipid content in extreme obesity.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
24453052 2014 Differences in UGT1A1, UGT1A7, and UGT1A9 polymorphisms between Uzbek and Japanese populations.
24255116 2014 Alteration of the function of the UDP-glucuronosyltransferase 1A subfamily by cytochrome P450 3A4: different susceptibility for UGT isoforms and UGT1A1/7 variants.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23789755 [Influence of genetic polymorphisms in UGT1A1, UGT1A7 and UGT1A9 on the pharmacokynetics of irinotecan, SN-38 and SN-38G].
23642732 2013 Association of SNPs in the UGT1A gene cluster with total bilirubin and mortality in the Diabetes Heart Study.
23371916 2013 A genome-wide association study for serum bilirubin levels and gene-environment interaction in a Chinese population.
More...