Property Summary

NCBI Gene PubMed Count 49
Grant Count 41
R01 Count 29
Funding $4,114,431.58
PubMed Score 58.84
PubTator Score 51.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 1.100 0.000
psoriasis 1.700 0.000

 GO Component (2)

 MGI Term (1)

Gene RIF (39)

PMID Text
26082189 And-1 coordinates with Claspin for efficient Chk1 activation in response to replication stress.
25216549 Functional analyses indicat that the expression TopBP1 and Claspin positively affects the survival of brain cancer cells after exposure to radiation.
24632611 USP29 interacts with Claspin and is able to deubiquitinate it both in vivo and in vitro.
23383325 Rad9, Rad17, TopBP1 and claspin play essential roles in heat-induced activation of ATR kinase and heat tolerance.
22863316 findings identify claspin as an in vivo substrate for the BRCA1 E3 ligase and suggest that its modification selectively triggers CHK1 activation for the homology-directed repair of a subset of genotoxic lesions
22732499 The conserved C terminus of Claspin interacts with Rad9 and ensures timely activation of the ATR-Chk1 pathway.
22731782 analysis of claspin expression could be clinically relevant in the diagnosis of HPV-related cervical lesions, in particular when applied to cervico-vaginal cytology
21945441 the functions of Claspin and the functional relationship between Claspin and Rad17 were studied.
21775519 In the presence of BRCA1, endogenous HERC2 interacts with Claspin, a protein essential for G(2)-M checkpoint activation and replication fork stability.
21502314 Tethering DNA damage checkpoint mediator proteins topoisomerase IIbeta-binding protein 1 (TopBP1) and Claspin to DNA activates ataxia-telangiectasia mutated and RAD3-related (ATR) phosphorylation of checkpoint kinase 1 (Chk1).
More...

AA Sequence

MTGEVGSEVHLEINDPNVISQEEADSPSDSGQGSYETIGPLSEGDSDEEIFVSKKLKNRKVLQDSDSETE      1 - 70
DTNASPEKTTYDSAEEENKENLYAGKNTKIKRIYKTVADSDESYMEKSLYQENLEAQVKPCLELSLQSGN     71 - 140
STDFTTDRKSSKKHIHDKEGTAGKAKVKSKRRLEKEERKMEKIRQLKKKETKNQEDDVEQPFNDSGCLLV    141 - 210
DKDLFETGLEDENNSPLEDEESLESIRAAVKNKVKKHKKKEPSLESGVHSFEEGSELSKGTTRKERKAAR    211 - 280
LSKEALKQLHSETQRLIRESALNLPYHMPENKTIHDFFKRKPRPTCHGNAMALLKSSKYQSSHHKEIIDT    281 - 350
ANTTEMNSDHHSKGSEQTTGAENEVETNALPVVSKETQIITGSDESCRKDLVKNEELEIQEKQKQSDIRP    351 - 420
SPGDSSVLQQESNFLGNNHSEECQVGGLVAFEPHALEGEGPQNPEETDEKVEEPEQQNKSSAVGPPEKVR    421 - 490
RFTLDRLKQLGVDVSIKPRLGADEDSFVILEPETNRELEALKQRFWKHANPAAKPRAGQTVNVNVIVKDM    491 - 560
GTDGKEELKADVVPVTLAPKKLDGASHTKPGEKLQVLKAKLQEAMKLRRFEERQKRQALFKLDNEDGFEE    561 - 630
EEEEEEEMTDESEEDGEEKVEKEEKEEELEEEEEKEEEEEEEGNQETAEFLLSSEEIETKDEKEMDKENN    631 - 700
DGSSEIGKAVGFLSVPKSLSSDSTLLLFKDSSSKMGYFPTEEKSETDENSGKQPSKLDEDDSCSLLTKES    701 - 770
SHNSSFELIGSTIPSYQPCNRQTGRGTSFFPTAGGFRSPSPGLFRASLVSSASKSSGKLSEPSLPIEDSQ    771 - 840
DLYNASPEPKTLFLGAGDFQFCLEDDTQSQLLDADGFLNVRNHRNQYQALKPRLPLASMDENAMDANMDE    841 - 910
LLDLCTGKFTSQAEKHLPRKSDKKENMEELLNLCSGKFTSQDASTPASSELNKQEKESSMGDPMEEALAL    911 - 980
CSGSFPTDKEEEDEEEEFGDFRLVSNDNEFDSDEDEHSDSGNDLALEDHEDDDEEELLKRSEKLKRQMRL    981 - 1050
RKYLEDEAEVSGSDVGSEDEYDGEEIDEYEEDVIDEVLPSDEELQSQIKKIHMKTMLDDDKRQLRLYQER   1051 - 1120
YLADGDLHSDGPGRMRKFRWKNIDDASQMDLFHRDSDDDQTEEQLDESEARWRKERIEREQWLRDMAQQG   1121 - 1190
KITAEEEEEIGEDSQFMILAKKVTAKALQKNASRPMVIQESKSLLRNPFEAIRPGSAQQVKTGSLLNQPK   1191 - 1260
AVLQKLAALSDHNPSAPRNSRNFVFHTLSPVKAEAAKESSKSQVKKRGPSFMTSPSPKHLKTDDSTSGLT   1261 - 1330
RSIFKYLES                                                                1331 - 1339
//

Text Mined References (62)

PMID Year Title
26082189 2015 And-1 coordinates with Claspin for efficient Chk1 activation in response to replication stress.
25216549 2014 TopBP1 and Claspin contribute to the radioresistance of lung cancer brain metastases.
24632611 2015 USP29 controls the stability of checkpoint adaptor Claspin by deubiquitination.
23910567 2013 Cell cycle-dependent formation of Cdc45-Claspin complexes in human cells is compromized by UV-mediated DNA damage.
23383325 2013 Rad9, Rad17, TopBP1 and claspin play essential roles in heat-induced activation of ATR kinase and heat tolerance.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22863316 2012 A DNA-damage selective role for BRCA1 E3 ligase in claspin ubiquitylation, CHK1 activation, and DNA repair.
22732499 2012 The conserved C terminus of Claspin interacts with Rad9 and promotes rapid activation of Chk1.
22731782 2012 Claspin as a biomarker of human papillomavirus-related high grade lesions of uterine cervix.
21945441 2011 Functional relationship between Claspin and Rad17.
More...