Property Summary

NCBI Gene PubMed Count 20
PubMed Score 3.14
PubTator Score 20.57

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (4)

Gene RIF (9)

AA Sequence

MPGRGRCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTGENEQVSRSQQ      1 - 70
RGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRAARLQKKEVLVGCCVLITCRQHNWPLTMGAICT     71 - 140
LLYADLDVFSSTYMQIVKLLGLDVPSLCLAELVKTYCSSFKLFQASPSVPAKYVEDKEKMLSRTMQLVEL    141 - 210
ANETWLVTGRHPLPVITAATFLAWQSLQPADRLSCSLARFCKLANVDLPYPASSRLQELLAVLLRMAEQL    211 - 280
AWLRVLRLDKRSVVKHIGDLLQHRQSLVRSAFRDGTAEVETREKEPPGWGQGQGEGEVGNNSLGLPQGKR    281 - 350
PASPALLLPPCMLKSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAARQAATSVPNPP     351 - 419
//

Text Mined References (29)

PMID Year Title