Property Summary

NCBI Gene PubMed Count 19
Grant Count 9
R01 Count 3
Funding $283,918.5
PubMed Score 3.14
PubTator Score 20.57

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
26638071 Study solved crystal structures of a human Brf2-TATA-binding complex bound to natural promoters, obtaining a detailed view of the molecular interactions occurring at Brf2-dependent Pol III promoters and highlighting the general structural and functional conservation of human Pol II and Pol III pre-initiation complexes.
24978456 hnRNP F is a co-factor in a subset of tristetraprolin/BRF1/BRF2-mediated mRNA decay.
24738062 These results suggested that BRF2 overexpression in tumor tissues is significantly associated with the poor prognosis of NSCLC patients through promoting epithelial-mesenchymal transition (EMT) program.
24523874 BRF2 may have a role in poor prognosis and anti-angiogenic therapy for early-stage non-small cell lung cancer
23550276 High expression of BRF2 is closely associated with tumor progression, angiogenesis, and poor survival in esophageal squamous cell cancer.
20668658 BRF2 can serve as a marker for lung squamous cell carcinoma and may provide a novel target for therapy.
18700021 deregulation of Brf1 and Brf2 expression could be a key mechanism responsible for the observed deregulation of RNA pol III transcription in cancer cells
16227591 C-terminal domain of Brf2 is required for efficient association of the protein with U6 promoter-bound TBP and SNAP(c), a type 3 promoter-specific transcription factor, and for efficient recruitment of Bdp1

AA Sequence

MPGRGRCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTGENEQVSRSQQ      1 - 70
RGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRAARLQKKEVLVGCCVLITCRQHNWPLTMGAICT     71 - 140
LLYADLDVFSSTYMQIVKLLGLDVPSLCLAELVKTYCSSFKLFQASPSVPAKYVEDKEKMLSRTMQLVEL    141 - 210
ANETWLVTGRHPLPVITAATFLAWQSLQPADRLSCSLARFCKLANVDLPYPASSRLQELLAVLLRMAEQL    211 - 280
AWLRVLRLDKRSVVKHIGDLLQHRQSLVRSAFRDGTAEVETREKEPPGWGQGQGEGEVGNNSLGLPQGKR    281 - 350
PASPALLLPPCMLKSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAARQAATSVPNPP     351 - 419
//

Text Mined References (28)

PMID Year Title
26638071 2015 Redox Signaling by the RNA Polymerase III TFIIB-Related Factor Brf2.
24978456 2014 hnRNP F complexes with tristetraprolin and stimulates ARE-mRNA decay.
24738062 2014 TFIIB-related factor 2 is associated with poor prognosis of nonsmall cell lung cancer patients through promoting tumor epithelial-mesenchymal transition.
24523874 2014 TFIIB-related factor 2 over expression is a prognosis marker for early-stage non-small cell lung cancer correlated with tumor angiogenesis.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23550276 2013 Overexpression of TFIIB-related factor 2 is significantly correlated with tumor angiogenesis and poor survival in patients with esophageal squamous cell cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20668658 2010 Integrative genomic analyses identify BRF2 as a novel lineage-specific oncogene in lung squamous cell carcinoma.
18700021 2008 Differential expression of the TFIIIB subunits Brf1 and Brf2 in cancer cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...