Property Summary

NCBI Gene PubMed Count 8
Grant Count 51
R01 Count 45
Funding $5,221,656.72
PubMed Score 349.59
PubTator Score 46.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 0.036
psoriasis 1.600 0.000
pancreatic ductal adenocarcinoma liver m... -1.717 0.025
lung cancer 1.600 0.007
ovarian cancer 2.100 0.000

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
12840016 The low resolution structure of human GrpE presented suggests that GrpE is a symmetric dimer when not bound to DnaK

AA Sequence

MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQ      1 - 70
LKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNL     71 - 140
YEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPAL    141 - 210
VGVVKEA                                                                   211 - 217
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12840016 2003 Free human mitochondrial GrpE is a symmetric dimer in solution.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...