Property Summary

NCBI Gene PubMed Count 9
PubMed Score 352.22
PubTator Score 46.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0
Disease Target Count P-value
psoriasis 6694 1.6e-04
ovarian cancer 8520 1.1e-03
lung cancer 4740 7.1e-03
pancreatic ductal adenocarcinoma liver metastasis 1962 2.5e-02
astrocytic glioma 2597 2.7e-02

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.100 2.7e-02
lung cancer 1.600 7.1e-03
ovarian cancer 1.300 1.1e-03
pancreatic ductal adenocarcinoma liver m... -1.717 2.5e-02
psoriasis 1.600 1.6e-04

Synonym

Accession Q9HAV7 B2R783 Q549M6
Symbols GrpE
HMGE
mt-GrpE#1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQ      1 - 70
LKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNL     71 - 140
YEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPAL    141 - 210
VGVVKEA                                                                   211 - 217
//

Text Mined References (14)

PMID Year Title