Property Summary

NCBI Gene PubMed Count 8
PubMed Score 349.59
PubTator Score 46.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
HIV Infections 100
Disease Target Count P-value
ovarian cancer 8492 3.11949698437179E-6
psoriasis 6685 1.58487287777422E-4
lung cancer 4473 0.00710913069679966
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0253815780502385
astrocytic glioma 2241 0.0357325595691348
Disease Target Count Z-score Confidence
Human monocytic ehrlichiosis 6 3.517 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 0.036
psoriasis 1.600 0.000
pancreatic ductal adenocarcinoma liver m... -1.717 0.025
lung cancer 1.600 0.007
ovarian cancer 2.100 0.000

Synonym

Accession Q9HAV7 B2R783 Q549M6
Symbols GrpE
HMGE
mt-GrpE#1

Gene

PANTHER Protein Class (1)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
12840016 The low resolution structure of human GrpE presented suggests that GrpE is a symmetric dimer when not bound to DnaK

AA Sequence

MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQ      1 - 70
LKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNL     71 - 140
YEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPAL    141 - 210
VGVVKEA                                                                   211 - 217
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12840016 2003 Free human mitochondrial GrpE is a symmetric dimer in solution.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...