Property Summary

NCBI Gene PubMed Count 24
PubMed Score 19.35
PubTator Score 19.01

Knowledge Summary

Patent

No data available

Expression

Gene RIF (16)

AA Sequence

MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRV      1 - 70
QKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAFQLSLVEADTPTVPPQEATLV     71 - 140
ALVSSLLVVFTLAFLGLFFLYCKQFFNRHCQRGGLLQFEADKTAKEESLFPVPPSKETSAESQVSENIFQ    141 - 210
TQPLNPILEDDCSSTSGFPTQESFTMASCTSESHSHWVHSPIECTELDLQKFSSSASYTGAETLGGNTVE    211 - 280
STGDRLELNVPFEVPSP                                                         281 - 297
//

Text Mined References (25)

PMID Year Title