Property Summary

NCBI Gene PubMed Count 22
Grant Count 10
R01 Count 5
Funding $169,124.67
PubMed Score 17.29
PubTator Score 19.01

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

PMID Text
26260321 XEDAR activates the non-canonical NF-kappaB pathway.
23959643 To investigate the evolutionary history of the EDA2R/AR intergenic region, we characterized the haplotype structure of 52 of its highly differentiated SNPs. Nearly all human X chromosomes carry one of two modal haplotypes for these 52 SNPs.
22309448 The results suggest that EDA2R confers susceptibility to early onset female pattern hair loss
21724072 association in dental crowding in the Hong Kong Chinese population
20501644 A crucial role of the EDA-A2/ectodysplasin A2 (XEDAR) interaction is revealed in the p53-signaling pathway.
20199557 because no frequent variant other than rs1385699 has been reported in EDA2R in the European population, it is probable that the causative variant(s) modifies the expression of one or more flanking genes, i.e. AR and EDA2R
19590514 Observational study of gene-disease association. (HuGE Navigator)
19543321 XEDAR is a putative tumor suppressor that could prevent malignant transformation and tumor progression by regulating apoptosis and anoikis.
19373488 androgen receptor/ectodysplasin A2 receptor haplotype may have a role in male pattern baldness
18385763 The androgen receptor gene and EDA2R are significantly associated with androgenetic alopecia.
More...

AA Sequence

MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRV      1 - 70
QKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAFQLSLVEADTPTVPPQEATLV     71 - 140
ALVSSLLVVFTLAFLGLFFLYCKQFFNRHCQRGGLLQFEADKTAKEESLFPVPPSKETSAESQVSENIFQ    141 - 210
TQPLNPILEDDCSSTSGFPTQESFTMASCTSESHSHWVHSPIECTELDLQKFSSSASYTGAETLGGNTVE    211 - 280
STGDRLELNVPFEVPSP                                                         281 - 297
//

Text Mined References (23)

PMID Year Title
27144394 2016 Functional Study of Ectodysplasin-A Mutations Causing Non-Syndromic Tooth Agenesis.
26260321 2015 XEDAR activates the non-canonical NF-?B pathway.
23959643 2012 A tale of two haplotypes: the EDA2R/AR Intergenic region is the most divergent genomic segment between Africans and East Asians in the human genome.
22309448 2012 Investigation of the male pattern baldness major genetic susceptibility loci AR/EDA2R and 20p11 in female pattern hair loss.
21724072 2011 Analysis of genetic polymorphisms in skeletal Class I crowding.
20501644 2010 Crosstalk of EDA-A2/XEDAR in the p53 signaling pathway.
20199557 2010 Fine mapping of the human AR/EDA2R locus in androgenetic alopecia.
19590514 2009 FGFR2 is associated with hair thickness in Asian populations.
19543321 2009 XEDAR as a putative colorectal tumor suppressor that mediates p53-regulated anoikis pathway.
19373488 2009 Recent positive selection of a human androgen receptor/ectodysplasin A2 receptor haplotype and its relationship to male pattern baldness.
More...