Property Summary

NCBI Gene PubMed Count 46
Grant Count 53
R01 Count 33
Funding $14,739,350.17
PubMed Score 74.14
PubTator Score 64.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.200 0.002
ependymoma 1.300 0.003
oligodendroglioma 1.400 0.002
group 3 medulloblastoma 1.900 0.000
atypical teratoid / rhabdoid tumor 1.700 0.000
glioblastoma 1.200 0.000
medulloblastoma, large-cell 2.300 0.000
primitive neuroectodermal tumor 1.500 0.000
non-small cell lung cancer 1.308 0.000
ovarian cancer 1.100 0.000

Gene RIF (28)

PMID Text
26976605 XPO5 role in microRNA biogenesis
26878725 NUP93 and exportin 5 interact with the signaling protein SMAD4 and that NUP93 mutations abrogated interaction with SMAD4
26147304 Variations in XPO5 rs11077 of Korean patients are significantly associated with their risk of colorectal cancer.
25911113 Knockdown of exportins 4, 5, and 7 altered thyroid hormone receptor shuttling dynamics, and when exportins 5 and 7 were overexpressed, TR distribution shifted toward the cytosol.
24209753 eEF1A binds to Snail transcription factors when bound to their main target, the E-cadherin promoter, facilitating their export to the cytoplasm in association with the aa-tRNA-Exportin5 complex.
24057215 The study identifies a miR-138-RMND5A-Exportin-5 as a previously unknown miRNA processing regulatory pathway in HeLa cells.
23549446 data demonstrate that the exportin 5 (XPO5) rs2257082 T variant allele occurs more frequently in primary ovarian insufficiency (POI)patients than in controls, suggesting that this allele may be associated with increased POI risk
22766726 Dicer, Drosha, and Exportin 5 genes were up-regulated in bladder urothelial carcinoma compared to normal urothelium. Silencing these genes induced cell proliferation inhibition and apoptosis in bladder urothelial carcinoma cells.
22539802 overall survival was significantly longer in multiple myeloma patients with C/C or A/C variant in the XPO5 gene single nucleotide polymorphism site rs11077
22190034 HIV-1 Vpu is identified to have a physical interaction with exportin 5 (XPO5) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
More...

AA Sequence

MAMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEKCPICVPCGLRLAEKTQVAIVRHFGLQI      1 - 70
LEHVVKFRWNGMSRLEKVYLKNSVMELIANGTLNILEEENHIKDALSRIVVEMIKREWPQHWPDMLIELD     71 - 140
TLSKQGETQTELVMFILLRLAEDVVTFQTLPPQRRRDIQQTLTQNMERIFSFLLNTLQENVNKYQQVKTD    141 - 210
TSQESKAQANCRVGVAALNTLAGYIDWVSMSHITAENCKLLEILCLLLNEQELQLGAAECLLIAVSRKGK    211 - 280
LEDRKPLMVLFGDVAMHYILSAAQTADGGGLVEKHYVFLKRLCQVLCALGNQLCALLGADSDVETPSNFG    281 - 350
KYLESFLAFTTHPSQFLRSSTQMTWGALFRHEILSRDPLLLAIIPKYLRASMTNLVKMGFPSKTDSPSCE    351 - 420
YSRFDFDSDEDFNAFFNSSRAQQGEVMRLACRLDPKTSFQMAGEWLKYQLSTFLDAGSVNSCSAVGTGEG    421 - 490
SLCSVFSPSFVQWEAMTLFLESVITQMFRTLNREEIPVNDGIELLQMVLNFDTKDPLILSCVLTNVSALF    491 - 560
PFVTYRPEFLPQVFSKLFSSVTFETVEESKAPRTRAVRNVRRHACSSIIKMCRDYPQLVLPNFDMLYNHV    561 - 630
KQLLSNELLLTQMEKCALMEALVLISNQFKNYERQKVFLEELMAPVASIWLSQDMHRVLSDVDAFIAYVG    631 - 700
TDQKSCDPGLEDPCGLNRARMSFCVYSILGVVKRTCWPTDLEEAKAGGFVVGYTSSGNPIFRNPCTEQIL    701 - 770
KLLDNLLALIRTHNTLYAPEMLAKMAEPFTKALDMLDAEKSAILGLPQPLLELNDSPVFKTVLERMQRFF    771 - 840
STLYENCFHILGKAGPSMQQDFYTVEDLATQLLSSAFVNLNNIPDYRLRPMLRVFVKPLVLFCPPEHYEA    841 - 910
LVSPILGPLFTYLHMRLSQKWQVINQRSLLCGEDEAADENPESQEMLEEQLVRMLTREVMDLITVCCVSK    911 - 980
KGADHSSAPPADGDDEEMMATEVTPSAMAELTDLGKCLMKHEDVCTALLITAFNSLAWKDTLSCQRTTSQ    981 - 1050
LCWPLLKQVLSGTLLADAVTWLFTSVLKGLQMHGQHDGCMASLVHLAFQIYEALRPRYLEIRAVMEQIPE   1051 - 1120
IQKDSLDQFDCKLLNPSLQKVADKRRKDQFKRLIAGCIGKPLGEQFRKEVHIKNLPSLFKKTKPMLETEV   1121 - 1190
LDNDGGGLATIFEP                                                           1191 - 1204
//

Text Mined References (52)

PMID Year Title
26976605 2016 Re-evaluation of the roles of DROSHA, Export in 5, and DICER in microRNA biogenesis.
26878725 2016 Mutations in nuclear pore genes NUP93, NUP205 and XPO5 cause steroid-resistant nephrotic syndrome.
26147304 2015 3'-UTR Polymorphisms in the MiRNA Machinery Genes DROSHA, DICER1, RAN, and XPO5 Are Associated with Colorectal Cancer Risk in a Korean Population.
25911113 2015 Multiple exportins influence thyroid hormone receptor localization.
24209753 2013 eEF1A mediates the nuclear export of SNAG-containing proteins via the Exportin5-aminoacyl-tRNA complex.
24057215 2014 MiR-138 downregulates miRNA processing in HeLa cells by targeting RMND5A and decreasing Exportin-5 stability.
23549446 2013 Association of polymorphisms in microRNA machinery genes (DROSHA, DICER1, RAN, and XPO5) with risk of idiopathic primary ovarian insufficiency in Korean women.
22766726 2013 Inducing cell proliferation inhibition and apoptosis via silencing Dicer, Drosha, and Exportin 5 in urothelial carcinoma of the bladder.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...