Property Summary

NCBI Gene PubMed Count 26
PubMed Score 5.97
PubTator Score 6.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease 1.321 2.7e-02
adult high grade glioma 1.300 3.0e-04
astrocytoma 1.100 5.9e-15
Astrocytoma, Pilocytic 1.100 5.8e-03
autosomal dominant Emery-Dreifuss muscul... 1.597 1.0e-03
Becker muscular dystrophy 1.067 2.0e-02
Breast cancer 2.000 3.0e-02
chronic lymphosyte leukemia -2.100 1.5e-04
Duchenne muscular dystrophy 1.982 2.7e-09
glioblastoma 1.100 3.5e-04
intraductal papillary-mucinous adenoma (... -2.600 1.3e-02
invasive ductal carcinoma 1.185 2.2e-03
juvenile dermatomyositis 2.137 8.8e-14
lung carcinoma -1.900 7.2e-27
medulloblastoma, large-cell -2.200 5.6e-03
osteosarcoma 1.950 3.4e-03
ovarian cancer -2.800 5.0e-05
pancreatic cancer 2.500 1.1e-03
primary pancreatic ductal adenocarcinoma 2.484 4.9e-04
primary Sjogren syndrome 1.300 1.2e-03
Rheumatoid arthritis 1.200 3.6e-03
sarcoidosis 1.200 1.1e-02
subependymal giant cell astrocytoma 1.396 3.2e-02
ulcerative colitis 2.500 1.6e-06

 IMPC Phenotype (2)

Protein-protein Interaction (1)

Gene RIF (9)

AA Sequence

MSELEQLRQEAEQLRNQIQDARKACNDATLVQITSNMDSVGRIQMRTRRTLRGHLAKIYAMHWGYDSRLL      1 - 70
VSASQDGKLIIWDSYTTNKMHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELP     71 - 140
GHTGYLSCCRFLDDSQIVTSSGDTTCALWDIETAQQTTTFTGHSGDVMSLSLSPDMRTFVSGACDASSKL    141 - 210
WDIRDGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLYSHDNIICGITSVAFSK    211 - 280
SGRLLLAGYDDFNCNVWDTLKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIWN              281 - 340
//

Text Mined References (27)

PMID Year Title