Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
medulloblastoma, large-cell 6241 3.6e-03

Expression

AA Sequence

MIIFQDLISHNEMFSDIYKIWEITNGLCLEVEQKMLSKTTGNTDDSLIGRNSSSESTEDEVTESTIITSV      1 - 70
DIVTNHHLQESIFTKEAYKKYIKDYMKSINEKLEEQRPERVKLFITGMKNKSSTSLLIFKTTSSLLVKT      71 - 139
//

Text Mined References (1)

PMID Year Title