Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
medulloblastoma, large-cell 6,234

AA Sequence

MIIFQDLISHNEMFSDIYKIWEITNGLCLEVEQKMLSKTTGNTDDSLIGRNSSSESTEDEVTESTIITSV      1 - 70
DIVTNHHLQESIFTKEAYKKYIKDYMKSINEKLEEQRPERVKLFITGMKNKSSTSLLIFKTTSSLLVKT      71 - 139
//

Text Mined References (1)

PMID Year Title
16421571 2006 DNA sequence and analysis of human chromosome 8.