Property Summary

NCBI Gene PubMed Count 77
PubMed Score 75.93
PubTator Score 59.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 2.3e-04
Breast cancer 2.900 2.3e-02
gastric cancer 1.300 5.7e-04
group 3 medulloblastoma 1.100 4.3e-03
hepatocellular carcinoma 1.100 1.9e-06
Hydrolethalus syndrome 1.162 4.0e-02
lung carcinoma -1.500 1.5e-18
Multiple myeloma 1.033 5.7e-03
non-small cell lung cancer -1.091 2.0e-10
osteosarcoma -1.053 3.3e-03
ovarian cancer -1.100 1.4e-04
pancreatic ductal adenocarcinoma liver m... 1.519 1.8e-03
pediatric high grade glioma 1.200 4.7e-03
Pick disease 1.400 1.5e-06
primitive neuroectodermal tumor 1.800 1.1e-04
spina bifida -1.699 4.7e-02
tuberculosis -1.500 4.1e-05

Protein-protein Interaction (9)

Gene RIF (52)

AA Sequence

MSNPGGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPKWNQHYDLYIG      1 - 70
KSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKLGPNDNDTVRGQIVVSLQSRD     71 - 140
RIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHITRTTQWERPTRPASEYSSPGRPLSCFVDENT    141 - 210
PISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWH    211 - 280
DPRVPRDLSNINCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQ    281 - 350
QVVSLCPDDTECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWK    351 - 420
RLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIM    421 - 490
GMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILENDITGVLDHTFCVEHNAYGEII    491 - 560
QHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKTFDEKELELIICGLG    561 - 630
KIDVNDWKVNTRLKHCTPDSNIVKWFWKAVEFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTI    631 - 700
HQIDACTNNLPKAHTCFNRIDIPPYESYEKLYEKLLTAIEETCGFAVE                          701 - 748
//

Text Mined References (81)

PMID Year Title