Property Summary

NCBI Gene PubMed Count 68
PubMed Score 61.95
PubTator Score 59.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.54330063600766E-18
non-small cell lung cancer 2798 1.95546085103036E-10
Pick disease 1893 1.53567424686244E-6
hepatocellular carcinoma 550 1.92190042529119E-6
group 4 medulloblastoma 1875 5.33385541142235E-6
ovarian cancer 8492 9.10747643021705E-6
tuberculosis 1563 4.13355341244544E-5
primitive neuroectodermal tumor 3031 1.13249878594332E-4
pilocytic astrocytoma 3086 1.93627284563673E-4
gastric cancer 436 5.73203738533281E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00184819170481582
osteosarcoma 7933 0.00398881870237185
pediatric high grade glioma 2712 0.00465770169965366
Multiple myeloma 1328 0.00565861652228192
Breast cancer 3099 0.0230083177701463
Hydrolethalus syndrome 128 0.0396617889844373
spina bifida 1064 0.0474623440750146
Disease Target Count Z-score Confidence
Renal fibrosis 4 3.641 1.8

Expression

  Differential Expression (17)

Disease log2 FC p
gastric cancer 1.300 0.001
hepatocellular carcinoma 1.100 0.000
Multiple myeloma 1.033 0.006
osteosarcoma 1.586 0.004
group 4 medulloblastoma 2.400 0.000
primitive neuroectodermal tumor 1.800 0.000
tuberculosis -1.500 0.000
pancreatic ductal adenocarcinoma liver m... 1.519 0.002
non-small cell lung cancer -1.091 0.000
Hydrolethalus syndrome 1.162 0.040
Breast cancer 2.900 0.023
pediatric high grade glioma 1.200 0.005
pilocytic astrocytoma 1.300 0.000
lung carcinoma -1.500 0.000
spina bifida -1.699 0.047
Pick disease 1.400 0.000
ovarian cancer 2.500 0.000

Synonym

Accession Q9HAU4 Q52LL1 Q9H260 hSMURF2
Symbols

Gene

PANTHER Protein Class (2)

PDB

2DJY   2KXQ   2LTZ   1ZVD   2JQZ  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

 GWAS Trait (1)

Gene RIF (45)

PMID Text
26743567 the findings of this study demonstrate that the downregulation of SnoN expression in hRPTECs under high-glucose conditions is mediated by the increased expression of Smurf2 through the TGF-b1/Smad signaling pathway.
26435193 SMURF2 is a critical target of USP15 in the TGF-beta signaling pathway.
26166038 Data show that miR15b mediates SMURF2 expression in pancreatic cancer and suggest miR15b as an oncogene by promoting epithelial-mesenchymal transition and SMURF2 as a tumor suppressor gene which expression is inhibited by miR15b in pancreatic cancer.
26126536 Methylation by PRMT1 may regulate Smurf2 stability and control TGF-beta signaling.
25524739 miR-424 regulates the myofibroblast differentiation during epithelial-to-mesenchymal transition by potentiating the TGF-beta signaling pathway, likely through Smurf2.
25438670 Studies on Smurf2 and Nedd4 show that the C2 domain has the potential to regulate E3 activity by maintaining the HECT domain in a low-activity state where its ability for transthiolation and noncovalent Ubiquitin binding are impaired.
25051198 Results suggest that elevated transcription and expression levels of ubiquitin ligase E3s WWP1, Smurf1 and Smurf2 genes may be the mechanisms of occurrence, development and metastasis of prostate cancer.
24803334 These results suggest a novel regulatory mechanism for YY1 function by Smurf2.
24729608 that Smurf2 is an important nonredundant negative regulator of virus-triggered type I IFN signaling by targeting VISA for K48-linked ubiquitination and degradation.
24709419 The SMURF2:UBCH5 complex is critical in maintaining KRAS protein stability.
More...

AA Sequence

MSNPGGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPKWNQHYDLYIG      1 - 70
KSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKLGPNDNDTVRGQIVVSLQSRD     71 - 140
RIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHITRTTQWERPTRPASEYSSPGRPLSCFVDENT    141 - 210
PISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWH    211 - 280
DPRVPRDLSNINCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQ    281 - 350
QVVSLCPDDTECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWK    351 - 420
RLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIM    421 - 490
GMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILENDITGVLDHTFCVEHNAYGEII    491 - 560
QHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKTFDEKELELIICGLG    561 - 630
KIDVNDWKVNTRLKHCTPDSNIVKWFWKAVEFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTI    631 - 700
HQIDACTNNLPKAHTCFNRIDIPPYESYEKLYEKLLTAIEETCGFAVE                          701 - 748
//

Text Mined References (72)

PMID Year Title
26743567 2016 The downregulation of SnoN expression in human renal proximal tubule epithelial cells under high-glucose conditions is mediated by an increase in Smurf2 expression through TGF-?1 signaling.
26435193 2015 USP15 regulates SMURF2 kinetics through C-lobe mediated deubiquitination.
26166038 2015 miR-15b promotes epithelial-mesenchymal transition by inhibiting SMURF2 in pancreatic cancer.
26126536 2015 Protein Arginine Methyltransferase 1 Methylates Smurf2.
25524739 2015 Regulation of myofibroblast differentiation by miR-424 during epithelial-to-mesenchymal transition.
25438670 2014 Structural and functional framework for the autoinhibition of Nedd4-family ubiquitin ligases.
25051198 2014 Bortezomib prevents oncogenesis and bone metastasis of prostate cancer by inhibiting WWP1, Smurf1 and Smurf2.
24803334 2014 Smurf2 regulates the degradation of YY1.
24729608 2014 Smurf2 negatively modulates RIG-I-dependent antiviral response by targeting VISA/MAVS for ubiquitination and degradation.
24709419 2014 KRAS protein stability is regulated through SMURF2: UBCH5 complex-mediated ?-TrCP1 degradation.
More...