Property Summary

NCBI Gene PubMed Count 18
Grant Count 2
Funding $9,650.12
PubMed Score 3.71
PubTator Score 2.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.042
astrocytic glioma 1.800 0.006
ependymoma 2.300 0.002
oligodendroglioma 1.600 0.005
psoriasis -1.400 0.000
osteosarcoma 3.038 0.000
glioblastoma -1.300 0.012
Duchenne muscular dystrophy 1.122 0.000
adrenocortical carcinoma 1.528 0.006
intraductal papillary-mucinous adenoma (... 2.000 0.002
intraductal papillary-mucinous carcinoma... 1.800 0.002
interstitial cystitis -1.100 0.001
aldosterone-producing adenoma -2.105 0.022
Pick disease 1.100 0.002
ovarian cancer -1.200 0.003
pituitary cancer 1.800 0.000
chronic rhinosinusitis -1.311 0.003

Gene RIF (1)

PMID Text
25316811 PLEKHA5 expression in melanoma tumors was associated with early development of brain metastases

AA Sequence

MAADLNLEWISLPRSWTYGITRGGRVFFINEEAKSTTWLHPVTGEAVVTGHRRQSTDLPTGWEEAYTFEG      1 - 70
ARYYINHNERKVTCKHPVTGQPSQDNCIFVVNEQTVATMTSEEKKERPISMINEASNYNVTSDYAVHPMS     71 - 140
PVGRTSRASKKVHNFGKRSNSIKRNPNAPVVRRGWLYKQDSTGMKLWKKRWFVLSDLCLFYYRDEKEEGI    141 - 210
LGSILLPSFQIALLTSEDHINRKYAFKAAHPNMRTYYFCTDTGKEMELWMKAMLDAALVQTEPVKRVDKI    211 - 280
TSENAPTKETNNIPNHRVLIKPEIQNNQKNKEMSKIEEKKALEAEKYGFQKDGQDRPLTKINSVKLNSLP    281 - 350
SEYESGSACPAQTVHYRPINLSSSENKIVNVSLADLRGGNRPNTGPLYTEADRVIQRTNSMQQLEQWIKI    351 - 420
QKGRGHEEETRGVISYQTLPRNMPSHRAQIMARYPEGYRTLPRNSKTRPESICSVTPSTHDKTLGPGAEE    421 - 490
KRRSMRDDTMWQLYEWQQRQFYNKQSTLPRHSTLSSPKTMVNISDQTMHSIPTSPSHGSIAAYQGYSPQR    491 - 560
TYRSEVSSPIQRGDVTIDRRHRAHHPKHVYVPDRRSVPAGLTLQSVSPQSLQGKTLSQDEGRGTLYKYRP    561 - 630
EEVDIDAKLSRLCEQDKVVHALEEKLQQLHKEKYTLEQALLSASQEIEMHADNPAAIQTVVLQRDDLQNG    631 - 700
LLSTCRELSRATAELERAWREYDKLEYDVTVTRNQMQEQLDHLGEVQTESAGIQRAQIQKELWRIQDVME    701 - 770
GLSKHKQQRGTTEIGMIGSKPFSTVKYKNEGPDYRLYKSEPELTTVAEVDESNGEEKSEPVSEIETSVVK    771 - 840
GSHFPVGVVPPRAKSPTPESSTIASYVTLRKTKKMMDLRTERPRSAVEQLCLAESTRPRMTVEEQMERIR    841 - 910
RHQQACLREKKKGLNVIGASDQSPLQSPSNLRDNPFRTTQTRRRDDKELDTAIRENDVKPDHETPATEIV    911 - 980
QLKETEPQNVDFSKELKKTENISYEMLFEPEPNGVNSVEMMDKERNKDKMPEDVTFSPQDETQTANHKPE    981 - 1050
EHPEENTKNSVDEQEETVISYESTPEVSRGNQTMAVKSLSPSPESSASPVPSTQPQLTEGSHFMCV       1051 - 1116
//

Text Mined References (29)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25316811 2015 PLEKHA5 as a Biomarker and Potential Mediator of Melanoma Brain Metastasis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22037487 2012 Identification and characterization of splicing variants of PLEKHA5 (Plekha5) during brain development.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...