Property Summary

NCBI Gene PubMed Count 19
PubMed Score 2.50
PubTator Score 5.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -1.288 1.6e-03
Atopic dermatitis -1.300 1.4e-03
atypical teratoid / rhabdoid tumor -1.100 2.8e-02
Breast cancer -3.000 1.8e-32
breast carcinoma -1.600 1.7e-06
cystic fibrosis -1.505 6.3e-05
ductal carcinoma in situ -1.500 1.5e-03
intraductal papillary-mucinous carcinoma... -2.000 1.4e-02
invasive ductal carcinoma -1.900 1.2e-03
lung cancer -2.200 3.6e-03
malignant mesothelioma 3.300 6.7e-09
medulloblastoma 1.200 1.3e-02
pancreatic cancer -1.500 2.5e-04
pituitary cancer -1.100 3.0e-02
primary pancreatic ductal adenocarcinoma -1.453 2.1e-04
psoriasis -1.500 1.4e-09
Rheumatoid arthritis 1.100 3.9e-02
subependymal giant cell astrocytoma -1.473 4.6e-02
urothelial carcinoma -1.700 5.0e-03

Protein-protein Interaction (2)

Gene RIF (5)

AA Sequence

MFSPGQEEHCAPNKEPVKYGELVVLGYNGALPNGDRGRRKSRFALYKRPKANGVKPSTVHVISTPQASKA      1 - 70
ISCKGQHSISYTLSRNQTVVVEYTHDKDTDMFQVGRSTESPIDFVVTDTISGSQNTDEAQITQSTISRFA     71 - 140
CRIVCDRNEPYTARIFAAGFDSSKNIFLGEKAAKWKNPDGHMDGLTTNGVLVMHPRGGFTEESQPGVWRE    141 - 210
ISVCGDVYTLRETRSAQQRGKLVESETNVLQDGSLIDLCGATLLWRTADGLFHTPTQKHIEALRQEINAA    211 - 280
RPQCPVGLNTLAFPSINRKEVVEEKQPWAYLSCGHVHGYHNWGHRSDTEANERECPMCRTVGPYVPLWLG    281 - 350
CEAGFYVDAGPPTHAFTPCGHVCSEKSAKYWSQIPLPHGTHAFHAACPFCATQLVGEQNCIKLIFQGPID    351 - 420
//

Text Mined References (21)

PMID Year Title