Property Summary

NCBI Gene PubMed Count 18
PubMed Score 2.50
PubTator Score 5.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Synonym

Accession Q9HAT8 B2RDY5 Pellino-2
Symbols

Gene

PDB

3EGA   3EGB  

Gene RIF (5)

PMID Text
25027698 A high-affinity Pellino2 e3 ubiquitin ligase binding domain is specific for phosphothreonine motifs.
22669975 Pellino 2 plays a critical role for TLR/IL-1R-mediated post-transcriptional control.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12860405 Pellino2 interacts with kinase-active as well as kinase-inactive IRAK1 and IRAK4
12804775 interacts with TRAF6 (tumor necrosis factor receptor associated factor 6) and TAK1 (transforming growth factor-beta activated kinase 1); can activate the mitogen activated protein kinase pathway

AA Sequence

MFSPGQEEHCAPNKEPVKYGELVVLGYNGALPNGDRGRRKSRFALYKRPKANGVKPSTVHVISTPQASKA      1 - 70
ISCKGQHSISYTLSRNQTVVVEYTHDKDTDMFQVGRSTESPIDFVVTDTISGSQNTDEAQITQSTISRFA     71 - 140
CRIVCDRNEPYTARIFAAGFDSSKNIFLGEKAAKWKNPDGHMDGLTTNGVLVMHPRGGFTEESQPGVWRE    141 - 210
ISVCGDVYTLRETRSAQQRGKLVESETNVLQDGSLIDLCGATLLWRTADGLFHTPTQKHIEALRQEINAA    211 - 280
RPQCPVGLNTLAFPSINRKEVVEEKQPWAYLSCGHVHGYHNWGHRSDTEANERECPMCRTVGPYVPLWLG    281 - 350
CEAGFYVDAGPPTHAFTPCGHVCSEKSAKYWSQIPLPHGTHAFHAACPFCATQLVGEQNCIKLIFQGPID    351 - 420
//

Text Mined References (21)

PMID Year Title
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
25027698 2014 The pellino e3 ubiquitin ligases recognize specific phosphothreonine motifs and have distinct substrate specificities.
23192594 2013 Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
22669975 2012 Pellino 2 is critical for Toll-like receptor/interleukin-1 receptor (TLR/IL-1R)-mediated post-transcriptional control.
21460395 2011 A genome-wide association study identifies a locus on chromosome 14q21 as a predictor of leukocyte telomere length and as a marker of susceptibility for bladder cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19081057 2008 Pellino proteins contain a cryptic FHA domain that mediates interaction with phosphorylated IRAK1.
17997719 2008 The IRAK-catalysed activation of the E3 ligase function of Pellino isoforms induces the Lys63-linked polyubiquitination of IRAK1.
17675297 2007 Kinase-active interleukin-1 receptor-associated kinases promote polyubiquitination and degradation of the Pellino family: direct evidence for PELLINO proteins being ubiquitin-protein isopeptide ligases.
More...