Property Summary

NCBI Gene PubMed Count 24
PubMed Score 158.75
PubTator Score 44.24

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.700 3.0e-05
astrocytic glioma -1.500 1.9e-02
ependymoma -1.600 2.8e-02
group 3 medulloblastoma -1.800 2.5e-05
medulloblastoma, large-cell -2.400 6.4e-06
oligodendroglioma -1.300 3.7e-02
osteosarcoma 1.598 1.4e-03
ovarian cancer 1.200 4.5e-04
pancreatic ductal adenocarcinoma liver m... -1.492 9.9e-03
Pick disease -1.500 2.4e-05
primitive neuroectodermal tumor -1.200 1.5e-02
tuberculosis 1.400 8.8e-06
ulcerative colitis -1.100 8.3e-05

Gene RIF (13)

AA Sequence

MVAPGLVLGLVLPLILWADRSAGIGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVTLRQGQETIMK      1 - 70
KVTSVKAHSDTWMVVLDPMKPGGPFEVMAQQTLEKINFTLRVHDVLFGDVWLCSGQSNMQMTVLQIFNAT     71 - 140
RELSNTAAYQSVRILSVSPIQAEQELEDLVAVDLQWSKPTSENLGHGYFKYMSAVCWLFGRHLYDTLQYP    141 - 210
IGLIASSWGGTPIEAWSSGRSLKACGVPKQGSIPYDSVTGPSKHSVLWNAMIHPLCNMTLKGVVWYQGES    211 - 280
NINYNTDLYNCTFPALIEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYV    281 - 350
PNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGL    351 - 420
LNLTYYQQIQVQKKDNKIFEISCCSDHRCKWLPASMNTVSTQSLTLAIDSCHGTVVALRYAWTTWPCEYK    421 - 490
QCPLYHPSSALPAPPFIAFITDQGPGHQSNVAK                                         491 - 523
//

Text Mined References (27)

PMID Year Title