Property Summary

NCBI Gene PubMed Count 45
PubMed Score 55.04
PubTator Score 62.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease 3.364 1.2e-03
active ulcerative colitis 1.123 5.0e-02
Breast cancer -2.600 2.3e-15
colon cancer 2.300 5.8e-03
diabetes mellitus 1.300 1.0e-03
intraductal papillary-mucinous adenoma (... -1.300 2.4e-02
lung adenocarcinoma 1.600 8.5e-10
nasopharyngeal carcinoma 1.300 2.6e-02
osteosarcoma -1.011 4.4e-02
ovarian cancer -2.900 6.5e-05
pituitary cancer -1.100 3.4e-02
posterior fossa group B ependymoma 2.500 4.8e-06
psoriasis 1.100 6.1e-18

Gene RIF (37)

AA Sequence

MELRSTAAPRAEGYSNVGFQNEENFLENENTSGNNSIRSRAVQSREHTNTKQDEEQVTVEQDSPRNREHM      1 - 70
EDDDEEMQQKGCLERRYDTVCGFCRKHKTTLRHIIWGILLAGYLVMVISACVLNFHRALPLFVITVAAIF     71 - 140
FVVWDHLMAKYEHRIDEMLSPGRRLLNSHWFWLKWVIWSSLVLAVIFWLAFDTAKLGQQQLVSFGGLIMY    141 - 210
IVLLFLFSKYPTRVYWRPVLWGIGLQFLLGLLILRTDPGFIAFDWLGRQVQTFLEYTDAGASFVFGEKYK    211 - 280
DHFFAFKVLPIVVFFSTVMSMLYYLGLMQWIIRKVGWIMLVTTGSSPIESVVASGNIFVGQTESPLLVRP    281 - 350
YLPYITKSELHAIMTAGFSTIAGSVLGAYISFGVPSSHLLTASVMSAPASLAAAKLFWPETEKPKITLKN    351 - 420
AMKMESGDSGNLLEAATQGASSSISLVANIAVNLIAFLALLSFMNSALSWFGNMFDYPQLSFELICSYIF    421 - 490
MPFSFMMGVEWQDSFMVARLIGYKTFFNEFVAYEHLSKWIHLRKEGGPKFVNGVQQYISIRSEIIATYAL    491 - 560
CGFANIGSLGIVIGGLTSMAPSRKRDIASGAVRALIAGTVACFMTACIAGILSSTPVDINCHHVLENAFN    561 - 630
STFPGNTTKVIACCQSLLSSTVAKGPGEVIPGGNHSLYSLKGCCTLLNPSTFNCNGISNTF             631 - 691
//

Text Mined References (48)

PMID Year Title