Property Summary

NCBI Gene PubMed Count 42
Grant Count 9
R01 Count 5
Funding $469,109.93
PubMed Score 46.30
PubTator Score 62.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma -4.969 0.000
intraductal papillary-mucinous adenoma (... -3.000 0.005
colon cancer 2.300 0.006
active Crohn's disease 3.364 0.001
active ulcerative colitis 3.848 0.006
diabetes mellitus 1.300 0.001
lung adenocarcinoma 1.600 0.000
posterior fossa group B ependymoma 2.500 0.000
psoriasis 1.400 0.000
nasopharyngeal carcinoma 1.300 0.026
Breast cancer -4.700 0.000
ovarian cancer -2.900 0.000
pituitary cancer -1.100 0.034

Gene RIF (34)

PMID Text
26481311 The co-expression of galectin-4 and CNT3 proteins is not impaired in inflamed colon from patients with Crohn's disease, thereby anticipating the integrity of this system for drug targeting.
26188009 Genome-wide association analysis on normal hearing function identifies PCDH20 and SLC28A3 as good candidates for modulatory genes in the auditory system. [meta-analysis]
25955569 Results show that high CNT3 expression level is associated with overall favorable outcomes and is predictive of clinical outcomes in acute myeloid leukemia patients with t(8;21).
24361227 Genetic polymorphisms in SLC28A3, SLC29A1 and RRM1 can influence the clinical outcome of metastatic breast cancer patients treated with paclitaxel-gemcitabine chemotherapy.
24300978 The presence of homozygous major allele for SLC28A3 (CC genotype) were each associated with an almost two-fold increase in the formation clearance of dFdCTP.
23441093 Validation of variants in SLC28A3 and UGT1A6 as genetic markers predictive of anthracycline-induced cardiotoxicity in children.
23195617 association between ribavirin (RBV) serum levels and SLC28A2 rs11854484 genotype, as well as the replicated association of ITPA and SLC28A3 genetic polymorphisms with RBV-induced anemia and treatment response
21822668 Data show that ENT1, ENT2, ENT4 and CNT3 protein was detected on ovarian carcinoma cells in all effusions, with expression observed in 1-95% of tumor cells.
21346688 A genetic variant in SCL28A3 coding for the concentrative nucleoside transporter 3 protects patients with chronic hepatitis C against hemolytic anemia without affecting sustained virological response in hepatitis C virus genotype 1.
20643903 Acidic and hydrophobic motifs in the N terminus tail of the hCNT3 control ER export and cell surface expression levels in nonpolarized cells, whereas a putative beta-turn domain contributes to hCNT3 polarized surface expression in epithelial cells.
More...

AA Sequence

MELRSTAAPRAEGYSNVGFQNEENFLENENTSGNNSIRSRAVQSREHTNTKQDEEQVTVEQDSPRNREHM      1 - 70
EDDDEEMQQKGCLERRYDTVCGFCRKHKTTLRHIIWGILLAGYLVMVISACVLNFHRALPLFVITVAAIF     71 - 140
FVVWDHLMAKYEHRIDEMLSPGRRLLNSHWFWLKWVIWSSLVLAVIFWLAFDTAKLGQQQLVSFGGLIMY    141 - 210
IVLLFLFSKYPTRVYWRPVLWGIGLQFLLGLLILRTDPGFIAFDWLGRQVQTFLEYTDAGASFVFGEKYK    211 - 280
DHFFAFKVLPIVVFFSTVMSMLYYLGLMQWIIRKVGWIMLVTTGSSPIESVVASGNIFVGQTESPLLVRP    281 - 350
YLPYITKSELHAIMTAGFSTIAGSVLGAYISFGVPSSHLLTASVMSAPASLAAAKLFWPETEKPKITLKN    351 - 420
AMKMESGDSGNLLEAATQGASSSISLVANIAVNLIAFLALLSFMNSALSWFGNMFDYPQLSFELICSYIF    421 - 490
MPFSFMMGVEWQDSFMVARLIGYKTFFNEFVAYEHLSKWIHLRKEGGPKFVNGVQQYISIRSEIIATYAL    491 - 560
CGFANIGSLGIVIGGLTSMAPSRKRDIASGAVRALIAGTVACFMTACIAGILSSTPVDINCHHVLENAFN    561 - 630
STFPGNTTKVIACCQSLLSSTVAKGPGEVIPGGNHSLYSLKGCCTLLNPSTFNCNGISNTF             631 - 691
//

Text Mined References (45)

PMID Year Title
26481311 2016 Galectin-4 interacts with the drug transporter human concentrative nucleoside transporter 3 to regulate its function.
26188009 2015 Genome-wide association analysis on normal hearing function identifies PCDH20 and SLC28A3 as candidates for hearing function and loss.
25955569 2015 Concentrative nucleoside transporter 3 as a prognostic indicator for favorable outcome of t(8;21)-positive acute myeloid leukemia patients after cytarabine-based chemotherapy.
24361227 2014 Genetic polymorphisms of SLC28A3, SLC29A1 and RRM1 predict clinical outcome in patients with metastatic breast cancer receiving gemcitabine plus paclitaxel chemotherapy.
24300978 2014 SLC28A3 genotype and gemcitabine rate of infusion affect dFdCTP metabolite disposition in patients with solid tumours.
23918034 2014 Genome-wide association study (GWAS) for molar-incisor hypomineralization (MIH).
23441093 2013 Validation of variants in SLC28A3 and UGT1A6 as genetic markers predictive of anthracycline-induced cardiotoxicity in children.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23195617 2013 Impact of genetic SLC28 transporter and ITPA variants on ribavirin serum level, hemoglobin drop and therapeutic response in patients with HCV infection.
23192594 2013 Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study.
More...