Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.89
PubTator Score 0.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 1.84982387825049E-17
lung cancer 4473 2.89406022602273E-5
psoriasis 6685 2.17551137547713E-4
osteosarcoma 7933 0.00173719855823124
group 3 medulloblastoma 2254 0.00886884445516667

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.400 0.000
osteosarcoma -1.315 0.002
group 3 medulloblastoma 1.400 0.009
lung cancer 2.000 0.000
lung carcinoma 1.200 0.000

Synonym

Accession Q9HAS0 Q7Z2H4
Symbols SRI2
NJMU-R1

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

 Compartment GO Term (2)

AA Sequence

MLPSLQESMDGDEKELESSEEGGSAEERRLEPPSSSHYCLYSYRGSRLAQQRGDSEDGSPSGTNAETPSG      1 - 70
DDFSLSLADTNLPSEVEPELRSFIAKRLSRGAVFEGLGNVASVELKIPGYRVGCYYCLFQNEKLLPETVT     71 - 140
IDSERNPSEYVVCFLGGSEKGLELFRLELDKYIQGLKNNMNCEARGLESHIKSYLSSWFEDVVCPIQRVV    141 - 210
LLFQEKLTFLLHAALSYTPVEVKESDEKTKRDINRFLSVASLQGLIHEGTMTSLCMAMTEEQHKSVVIDC    211 - 280
SSSQPQFCNAGSNRFCEDWMQAFLNGAKGGNPFLFRQVLENFKLKAIQDTNNLKRFIRQAEMNHYALFKC    281 - 350
YMFLKNCGSGDILLKIVKVEHEEMPEAKNVIAVLEEFMKEALDQSF                            351 - 396
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23394947 2013 A systematic mammalian genetic interaction map reveals pathways underlying ricin susceptibility.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...