Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.89
PubTator Score 0.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2843 1.8e-17
lung cancer 4740 2.9e-05
psoriasis 6694 2.2e-04
osteosarcoma 7950 1.7e-03
group 3 medulloblastoma 4104 8.9e-03

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.400 8.9e-03
lung cancer 2.000 2.9e-05
lung carcinoma 1.200 1.8e-17
osteosarcoma -1.315 1.7e-03
psoriasis -1.400 2.2e-04

AA Sequence

MLPSLQESMDGDEKELESSEEGGSAEERRLEPPSSSHYCLYSYRGSRLAQQRGDSEDGSPSGTNAETPSG      1 - 70
DDFSLSLADTNLPSEVEPELRSFIAKRLSRGAVFEGLGNVASVELKIPGYRVGCYYCLFQNEKLLPETVT     71 - 140
IDSERNPSEYVVCFLGGSEKGLELFRLELDKYIQGLKNNMNCEARGLESHIKSYLSSWFEDVVCPIQRVV    141 - 210
LLFQEKLTFLLHAALSYTPVEVKESDEKTKRDINRFLSVASLQGLIHEGTMTSLCMAMTEEQHKSVVIDC    211 - 280
SSSQPQFCNAGSNRFCEDWMQAFLNGAKGGNPFLFRQVLENFKLKAIQDTNNLKRFIRQAEMNHYALFKC    281 - 350
YMFLKNCGSGDILLKIVKVEHEEMPEAKNVIAVLEEFMKEALDQSF                            351 - 396
//

Text Mined References (15)

PMID Year Title