Property Summary

NCBI Gene PubMed Count 32
Grant Count 35
R01 Count 15
Funding $6,005,517.96
PubMed Score 492.20
PubTator Score 84.65

Knowledge Summary

Patent (3,365)

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 0.015
glioblastoma -2.000 0.008
medulloblastoma -1.100 0.006
medulloblastoma, large-cell -3.300 0.000
Atopic dermatitis -1.400 0.002
adrenocortical adenoma 1.255 0.048
lung adenocarcinoma -2.200 0.000
aldosterone-producing adenoma -1.360 0.010
psoriasis -1.500 0.000
non-small cell lung carcinoma -1.300 0.000
Breast cancer -1.400 0.000
ductal carcinoma in situ -1.200 0.013
invasive ductal carcinoma -1.700 0.007
pituitary cancer 2.600 0.007
chronic rhinosinusitis -1.210 0.007

Gene RIF (18)

PMID Text
26235030 Results suggest that UNC5 and LPHN3 can simultaneously bind to FLRT3, forming a trimeric complex, and that FLRT3 may form transsynaptic complexes with both LPHN3 and UNC5.
25989180 LPHN3 confers ADHD susceptibility, and moderates methylphenidate treatment response in children and adolescents with ADHD.
25871512 Study examined the association between the LPHN3 rs6551665 A/G polymorphism and Attention deficit hyperactivity disorder (ADHD) in Korea; samples used in the study consisted of 150 ADHD children and 322 controls; ADHD children appeared to have a surplus of GG genotype, studies with larger sample sizes needed.
23317273 Increased LPHN3 mRNA expression levels correlated with axillary-node metastasis in breast cancer.
23245769 genetic association studies in Germany: Data suggest that, within a sample of patients with attention deficit disorder hyperactivity, SNPs in LPHN3 gene impacts behavioral and neurophysiological measures of cognitive response control.
22832519 A two-locus genetic interaction between LPHN3 and 11q predicts ADHD severity and long-term outcome.
22575564 The influence of LPHN3 genotype on attention deficit-hyperactivity disorder (ADHD) and addiction is mediated through alterations in transgenic monoamine signaling.
22486528 highly significant interaction between four SNPs and maternal stress during pregnancy and development of attention-deficit/hyperactivity disorder
22405201 This study demonistrated that LPHN3 and its ligand FLRT3 play an important role in glutamatergic synapse development.
22105624 This study identifying loci for aADHD and led to the identification of LPHN3 as novel genes associated with ADHD across the lifespan.
More...

AA Sequence

MWPSQLLIFMMLLAPIIHAFSRAPIPMAVVRRELSCESYPIELRCPGTDVIMIESANYGRTDDKICDSDP      1 - 70
AQMENIRCYLPDAYKIMSQRCNNRTQCAVVAGPDVFPDPCPGTYKYLEVQYECVPYKVEQKVFLCPGLLK     71 - 140
GVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRTDTLTEYSSKDDFIAGRPTTTYKLPHRVDGTG    141 - 210
FVVYDGALFFNKERTRNIVKFDLRTRIKSGEAIIANANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQ    211 - 280
NNGKIVISQLNPYTLRIEGTWDTAYDKRSASNAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTDQSKD    281 - 350
SLVDVPFPNSYQYIAAVDYNPRDNLLYVWNNYHVVKYSLDFGPLDSRSGQAHHGQVSYISPPIHLDSELE    351 - 420
RPSVKDISTTGPLGMGSTTTSTTLRTTTLSPGRSTTPSVSGRRNRSTSTPSPAVEVLDDMTTHLPSASSQ    421 - 490
IPALEESCEAVEAREIMWFKTRQGQIAKQPCPAGTIGVSTYLCLAPDGIWDPQGPDLSNCSSPWVNHITQ    491 - 560
KLKSGETAANIARELAEQTRNHLNAGDITYSVRAMDQLVGLLDVQLRNLTPGGKDSAARSLNKAMVETVN    561 - 630
NLLQPQALNAWRDLTTSDQLRAATMLLHTVEESAFVLADNLLKTDIVRENTDNIKLEVARLSTEGNLEDL    631 - 700
KFPENMGHGSTIQLSANTLKQNGRNGEIRVAFVLYNNLGPYLSTENASMKLGTEALSTNHSVIVNSPVIT    701 - 770
AAINKEFSNKVYLADPVVFTVKHIKQSEENFNPNCSFWSYSKRTMTGYWSTQGCRLLTTNKTHTTCSCNH    771 - 840
LTNFAVLMAHVEVKHSDAVHDLLLDVITWVGILLSLVCLLICIFTFCFFRGLQSDRNTIHKNLCISLFVA    841 - 910
ELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESEHSRRKYFYLVGYGMPAL    911 - 980
IVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPESGCLDNI    981 - 1050
KSWVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYGKCLRTHC   1051 - 1120
CSGKSTESSIGSGKTSGSRTPGRYSTGSQSRIRRMWNDTVRKQSESSFITGDINSSASLNREGLLNNARD   1121 - 1190
TSVMDTLPLNGNHGNSYSIASGEYLSNCVQIIDRGYNHNETALEKKILKELTSNYIPSYLNNHERSSEQN   1191 - 1260
RNLMNKLVNNLGSGREDDAIVLDDATSFNHEESLGLELIHEESDAPLLPPRVYSTENHQPHHYTRRRIPQ   1261 - 1330
DHSESFFPLLTNEHTEDLQSPHRDSLYTSMPTLAGVAATESVTTSTQTEPPPAKCGDAEDVYYKSMPNLG   1331 - 1400
SRNHVHQLHTYYQLGRGSSDGFIVPPNKDGTPPEGSSKGPAHLVTSL                          1401 - 1447
//

Text Mined References (33)

PMID Year Title
26235030 2015 Structural Basis of Latrophilin-FLRT-UNC5 Interaction in Cell Adhesion.
25989180 2015 LPHN3 and attention-deficit/hyperactivity disorder: a susceptibility and pharmacogenetic study.
25871512 2015 Association of LPHN3 rs6551665 A/G polymorphism with attention deficit and hyperactivity disorder in Korean children.
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
23317273 2012 Quantitative real-time RT-PCR of ITGA7, SVEP1, TNS1, LPHN3, SEMA3G, KLB and MMP13 mRNA expression in breast cancer.
23245769 2013 Influence of a latrophilin 3 (LPHN3) risk haplotype on event-related potential measures of cognitive response control in attention-deficit hyperactivity disorder (ADHD).
22832519 2011 A two-locus genetic interaction between LPHN3 and 11q predicts ADHD severity and long-term outcome.
22575564 2012 Initial characterization of mice null for Lphn3, a gene implicated in ADHD and addiction.
22486528 2012 LPHN3 and attention-deficit/hyperactivity disorder: interaction with maternal stress during pregnancy.
22405201 2012 FLRT proteins are endogenous latrophilin ligands and regulate excitatory synapse development.
More...