Property Summary

NCBI Gene PubMed Count 34
PubMed Score 511.05
PubTator Score 84.65

Knowledge Summary

Patent (3,365)

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical adenoma 1.255 4.8e-02
aldosterone-producing adenoma -1.293 2.1e-02
Atopic dermatitis -1.100 1.8e-03
atypical teratoid / rhabdoid tumor -1.300 2.1e-02
Breast cancer -1.400 1.8e-12
chronic rhinosinusitis -1.210 6.6e-03
ductal carcinoma in situ -1.200 1.3e-02
glioblastoma -1.600 4.6e-02
invasive ductal carcinoma -1.700 6.7e-03
lung adenocarcinoma -1.700 2.9e-14
medulloblastoma -1.100 5.8e-03
medulloblastoma, large-cell -2.500 2.3e-04
non-small cell lung carcinoma -1.300 2.6e-12
pituitary cancer 2.200 1.8e-02
psoriasis -1.400 7.0e-20

Gene RIF (20)

AA Sequence

MWPSQLLIFMMLLAPIIHAFSRAPIPMAVVRRELSCESYPIELRCPGTDVIMIESANYGRTDDKICDSDP      1 - 70
AQMENIRCYLPDAYKIMSQRCNNRTQCAVVAGPDVFPDPCPGTYKYLEVQYECVPYKVEQKVFLCPGLLK     71 - 140
GVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRTDTLTEYSSKDDFIAGRPTTTYKLPHRVDGTG    141 - 210
FVVYDGALFFNKERTRNIVKFDLRTRIKSGEAIIANANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQ    211 - 280
NNGKIVISQLNPYTLRIEGTWDTAYDKRSASNAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTDQSKD    281 - 350
SLVDVPFPNSYQYIAAVDYNPRDNLLYVWNNYHVVKYSLDFGPLDSRSGQAHHGQVSYISPPIHLDSELE    351 - 420
RPSVKDISTTGPLGMGSTTTSTTLRTTTLSPGRSTTPSVSGRRNRSTSTPSPAVEVLDDMTTHLPSASSQ    421 - 490
IPALEESCEAVEAREIMWFKTRQGQIAKQPCPAGTIGVSTYLCLAPDGIWDPQGPDLSNCSSPWVNHITQ    491 - 560
KLKSGETAANIARELAEQTRNHLNAGDITYSVRAMDQLVGLLDVQLRNLTPGGKDSAARSLNKAMVETVN    561 - 630
NLLQPQALNAWRDLTTSDQLRAATMLLHTVEESAFVLADNLLKTDIVRENTDNIKLEVARLSTEGNLEDL    631 - 700
KFPENMGHGSTIQLSANTLKQNGRNGEIRVAFVLYNNLGPYLSTENASMKLGTEALSTNHSVIVNSPVIT    701 - 770
AAINKEFSNKVYLADPVVFTVKHIKQSEENFNPNCSFWSYSKRTMTGYWSTQGCRLLTTNKTHTTCSCNH    771 - 840
LTNFAVLMAHVEVKHSDAVHDLLLDVITWVGILLSLVCLLICIFTFCFFRGLQSDRNTIHKNLCISLFVA    841 - 910
ELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESEHSRRKYFYLVGYGMPAL    911 - 980
IVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPESGCLDNI    981 - 1050
KSWVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYGKCLRTHC   1051 - 1120
CSGKSTESSIGSGKTSGSRTPGRYSTGSQSRIRRMWNDTVRKQSESSFITGDINSSASLNREGLLNNARD   1121 - 1190
TSVMDTLPLNGNHGNSYSIASGEYLSNCVQIIDRGYNHNETALEKKILKELTSNYIPSYLNNHERSSEQN   1191 - 1260
RNLMNKLVNNLGSGREDDAIVLDDATSFNHEESLGLELIHEESDAPLLPPRVYSTENHQPHHYTRRRIPQ   1261 - 1330
DHSESFFPLLTNEHTEDLQSPHRDSLYTSMPTLAGVAATESVTTSTQTEPPPAKCGDAEDVYYKSMPNLG   1331 - 1400
SRNHVHQLHTYYQLGRGSSDGFIVPPNKDGTPPEGSSKGPAHLVTSL                          1401 - 1447
//

Text Mined References (35)

PMID Year Title