Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.79
PubTator Score 4.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.600 3.2e-10
group 4 medulloblastoma -1.100 1.4e-04
inflammatory breast cancer -1.200 9.8e-03
medulloblastoma, large-cell -1.100 3.7e-04
nasopharyngeal carcinoma -1.200 8.3e-04
osteosarcoma -2.207 1.5e-06
ovarian cancer 1.200 6.3e-11

Protein-protein Interaction (1)

Gene RIF (2)

AA Sequence

MGTRKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQTDWSFKLDGVLHDASQDLVY      1 - 70
ETVAKDVVSQALDGYNGTIMCYGQTGAGKTYTMMGATENYKHRGILPRALQQVFRMIEERPTHAITVRVS     71 - 140
YLEIYNESLFDLLSTLPYVGPSVTPMTIVENPQGVFIKGLSVHLTSQEEDAFSLLFEGETNRIIASHTMN    141 - 210
KNSSRSHCIFTIYLEAHSRTLSEEKYITSKINLVDLAGSERLGKSGSEGQVLKEATYINKSLSFLEQAII    211 - 280
ALGDQKRDHIPFRQCKLTHALKDSLGGNCNMVLVTNIYGEAAQLEETLSSLRFASRMKLVTTEPAINEKY    281 - 350
DAERMVKNLEKELALLKQELAIHDSLTNRTFVTYDPMDEIQIAEINSQVRRYLEGTLDEIDIISLRQIKE    351 - 420
VFNQFRVVLSQQEQEVESTLRRKYTLIDRNDFAAISAIQKAGLVDVDGHLVGEPEGQNFGLGVAPFSTKP    421 - 490
GKKAKSKKTFKEPLSSLARKEGASSPVNGKDLDYVSTSKTQLVPSSKDGDVKDMLSRDRETSSIEPLPSD    491 - 560
SPKEELRPIRPDTPPSKPVAFEEFKNEQGSEINRIFKENKSILNERRKRASETTQHINAIKREIDVTKEA    561 - 630
LNFQKSLREKQGKYENKGLMIIDEEEFLLILKLKDLKKQYRSEYQDLRDLRAEIQYCQHLVDQCRHRLLM    631 - 700
EFDIWYNESFVIPEDMQMALKPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVLPEGPDSISFYNAKVK    701 - 770
IEQKHNYLKTMMGLQQAHRK                                                      771 - 790
//

Text Mined References (10)

PMID Year Title