Property Summary

NCBI Gene PubMed Count 7
Grant Count 2
Funding $229,625
PubMed Score 5.79
PubTator Score 4.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -2.207 0.000
posterior fossa group B ependymoma 2.700 0.000
medulloblastoma, large-cell -1.100 0.000
group 4 medulloblastoma -1.300 0.000
nasopharyngeal carcinoma -1.200 0.001
inflammatory breast cancer -1.200 0.010
ovarian cancer 2.000 0.000

Gene RIF (2)

PMID Text
22964304 Data show a mechanism by which GTPase Gem contributes to the mitotic progression by maintaining correct spindle length through the kinesin Kif9.
21119006 kinesin KIF9 and reggie/flotillin proteins are novel regulators of macrophage podosomes and their interaction is critical for podosomal matrix-degradation

AA Sequence

MGTRKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQTDWSFKLDGVLHDASQDLVY      1 - 70
ETVAKDVVSQALDGYNGTIMCYGQTGAGKTYTMMGATENYKHRGILPRALQQVFRMIEERPTHAITVRVS     71 - 140
YLEIYNESLFDLLSTLPYVGPSVTPMTIVENPQGVFIKGLSVHLTSQEEDAFSLLFEGETNRIIASHTMN    141 - 210
KNSSRSHCIFTIYLEAHSRTLSEEKYITSKINLVDLAGSERLGKSGSEGQVLKEATYINKSLSFLEQAII    211 - 280
ALGDQKRDHIPFRQCKLTHALKDSLGGNCNMVLVTNIYGEAAQLEETLSSLRFASRMKLVTTEPAINEKY    281 - 350
DAERMVKNLEKELALLKQELAIHDSLTNRTFVTYDPMDEIQIAEINSQVRRYLEGTLDEIDIISLRQIKE    351 - 420
VFNQFRVVLSQQEQEVESTLRRKYTLIDRNDFAAISAIQKAGLVDVDGHLVGEPEGQNFGLGVAPFSTKP    421 - 490
GKKAKSKKTFKEPLSSLARKEGASSPVNGKDLDYVSTSKTQLVPSSKDGDVKDMLSRDRETSSIEPLPSD    491 - 560
SPKEELRPIRPDTPPSKPVAFEEFKNEQGSEINRIFKENKSILNERRKRASETTQHINAIKREIDVTKEA    561 - 630
LNFQKSLREKQGKYENKGLMIIDEEEFLLILKLKDLKKQYRSEYQDLRDLRAEIQYCQHLVDQCRHRLLM    631 - 700
EFDIWYNESFVIPEDMQMALKPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVLPEGPDSISFYNAKVK    701 - 770
IEQKHNYLKTMMGLQQAHRK                                                      771 - 790
//

Text Mined References (9)

PMID Year Title
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
22964304 2012 The GTPase Gem and its partner Kif9 are required for chromosome alignment, spindle length control, and mitotic progression.
21119006 2011 The kinesin KIF9 and reggie/flotillin proteins regulate matrix degradation by macrophage podosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11483511 2001 The Ras-like GTPase Gem is involved in cell shape remodelling and interacts with the novel kinesin-like protein KIF9.