Property Summary

NCBI Gene PubMed Count 18
Grant Count 5
R01 Count 5
Funding $156,529.75
PubMed Score 5.00
PubTator Score 4.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -2.000 0.002
ependymoma -2.200 0.004
oligodendroglioma -2.000 0.004
glioblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
sonic hedgehog group medulloblastoma -1.600 0.000
medulloblastoma, large-cell -2.300 0.000
adult high grade glioma -1.900 0.000
pilocytic astrocytoma -1.300 0.000

Synonym

Accession Q9HAP6 Lin-7B
Symbols MALS2
VELI2
LIN-7B
MALS-2

Gene

PANTHER Protein Class (1)

PDB

2DKR  

Gene RIF (7)

PMID Text
25196215 functional deficiency in Lin-7B could be implicated in clinical phenotypes in some autism spectrum disorders patients through bringing about abnormal cortical architecture
20720508 Data suggest that decreased cortical LIN7b expression may contribute to abnormal corticostriatal connectivity in Huntington disease.
19460752 Knockdown of lin-7 homolog B (C. elegans) (LIN7B) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18286632 Allelic and haplotype association was found between both BDNF and adult ADHD, and LIN-7 and adult ADHD.
16979770 Lin-7B is a binding partner for Rhotekin in the human brain cDNA library
15317815 PSD-95 and Lin-7b interact with acid-sensing ion channel-3 and have opposite effects on H+- gated current
14596909 LIN7B is a partner of IRSp53 anchoring the actin-based membrane cytoskeleton at cell-cell contacts.

AA Sequence

MAALVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDITGSAEIR      1 - 70
AHATAKATVAAFTASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQL     71 - 140
LSVNGVSVEGEQHEKAVELLKAAQGSVKLVVRYTPRVLEEMEARFEKMRSARRRQQHQSYSSLESRG       141 - 207
//

Text Mined References (20)

PMID Year Title
25196215 2015 Role of an adaptor protein Lin-7B in brain development: possible involvement in autism spectrum disorders.
20720508 2010 Decreased Lin7b expression in layer 5 pyramidal neurons may contribute to impaired corticostriatal connectivity in huntington disease.
18286632 2008 Association study of brain-derived neurotrophic factor (BDNF) and LIN-7 homolog (LIN-7) genes with adult attention-deficit/hyperactivity disorder.
17237226 2007 The stardust family protein MPP7 forms a tripartite complex with LIN7 and DLG1 that regulates the stability and localization of DLG1 to cell junctions.
16979770 2006 Identification of a cell polarity-related protein, Lin-7B, as a binding partner for a Rho effector, Rhotekin, and their possible interaction in neurons.
16473877 2006 Ggamma13 interacts with PDZ domain-containing proteins.
16192277 2005 MJ0917 in archaeon Methanococcus jannaschii is a novel NADP phosphatase/NAD kinase.
16192269 2005 Purification of ATP-binding cassette transporter A1 and associated binding proteins reveals the importance of beta1-syntrophin in cholesterol efflux.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15317815 2004 PSD-95 and Lin-7b interact with acid-sensing ion channel-3 and have opposite effects on H+- gated current.
More...