Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.54
PubTator Score 0.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 4.5e-16
lung cancer 4740 3.2e-04
osteosarcoma 7950 2.8e-03
gastric carcinoma 807 9.8e-03
cutaneous lupus erythematosus 1057 4.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Klinefelter's syndrome 56 3.608 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 4.8e-02
gastric carcinoma 1.100 9.8e-03
lung cancer -1.100 3.2e-04
lung carcinoma -1.800 4.5e-16
osteosarcoma -1.003 2.8e-03

AA Sequence

MLSEGYLSGLEYWNDIHWSCASYNEQVAGEKEEETNSVATLSYSSVDETQVRSLYVSCKSSGKFISSVHS      1 - 70
RESQHSRSQRVTVLQTNPNPVFESPNLAAVEICRDASRETYLVPSSCKSICKNYNDLQIAGGQVMAINSV     71 - 140
TTDFPSESSFEYGPLLKSSEIPLPMEDSISTQPSDFPQKPIQRYSSYWRITSIKEKSSLQMQNPISNAVL    141 - 210
NEYLEQKVVELYKQYIMDTVFHDSSPTQILASELIMTSVDQISLQVSREKNLETSKARDIVFSRLLQLMS    211 - 280
TEITEISTPSLHISQYSNVNP                                                     281 - 301
//

Text Mined References (6)

PMID Year Title