Property Summary

NCBI Gene PubMed Count 10
Grant Count 2
Funding $159,000
PubMed Score 40.91
PubTator Score 17.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.312 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma 1.100 0.000
medulloblastoma, large-cell 1.200 0.001
COPD -1.100 0.001

Gene RIF (4)

PMID Text
17083929 In a mouse model, fibrosin upregulates the appearance of myofibroblasts during wound healing and may be important in the process of scarring.
11733950 Fibrosin stimulates epithelialization of wounds in mouse and reduces wound healing time by approximately 30-40%.
10493891 In a rat model, ethanol can directly stimulate fibroblast proliferation and production of fibrogenic cytokines, particularly fibrosin, which appears to contribute to alcohol-induced hepatic fibrosis in vivo.
7892239 Characterization of mouse fibrosin and demonstration of growth-stimulating effects in fibroblasts.

AA Sequence

MFEKYPGKMEGLFRHNPYTAFPPAVPGLPPGLPPAVSFGSLQGAFQPKSTNPELPPRLGPVPSGLSQKGT      1 - 70
QIPDHFRPPLRKPGKWCAMHVRVAYMILRHQEKMKGDSHKLDFRNDLLPCLPGPYGALPPGQELSHPASL     71 - 140
FTATGAVHAAANPFTAAPGAHGPFLSPSTHIDPFGRPTSFASLAALSNGAFGGLGSPTFNSGAVFAQKES    141 - 210
PGAPPAFASPPDPWGRLHRSPLTFPAWVRPPEAARTPGSDKERPVERREPSITKEEKDRDLPFSRPQLRV    211 - 280
SPATPKARAGEEGPRPTKESVRVKEERKEEAAAAAAAAAAAAAAAAAAATGPQGLHLLFERPRPPPFLGP    281 - 350
SPPDRCAGFLEPTWLAAPPRLARPPRFYEAGEELTGPGAVAAARLYGLEPAHPLLYSRLAPPPPPAAAPG    351 - 420
TPHLLSKTPPGALLGAPPPLVPAPRPSSPPRGPGPARADR                                  421 - 460
//

Text Mined References (14)

PMID Year Title
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17083929 2007 Fibrosin, a novel fibrogenic cytokine, modulates expression of myofibroblasts.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11733950 2001 Fibrosin: a novel lymphokine in wound healing.
More...