Property Summary

NCBI Gene PubMed Count 10
PubMed Score 42.92
PubTator Score 17.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 9.5e-06
atypical teratoid / rhabdoid tumor 5112 2.0e-05
glioblastoma 5792 6.6e-05
medulloblastoma, large-cell 6241 5.0e-04
COPD 118 1.1e-03
Disease Target Count Z-score Confidence
Schistosomiasis 35 3.988 2.0

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 2.0e-05
COPD -1.100 1.1e-03
glioblastoma 1.100 6.6e-05
medulloblastoma, large-cell 1.200 5.0e-04
osteosarcoma -1.312 9.5e-06

 Compartment GO Term (1)

Gene RIF (4)

AA Sequence

MFEKYPGKMEGLFRHNPYTAFPPAVPGLPPGLPPAVSFGSLQGAFQPKSTNPELPPRLGPVPSGLSQKGT      1 - 70
QIPDHFRPPLRKPGKWCAMHVRVAYMILRHQEKMKGDSHKLDFRNDLLPCLPGPYGALPPGQELSHPASL     71 - 140
FTATGAVHAAANPFTAAPGAHGPFLSPSTHIDPFGRPTSFASLAALSNGAFGGLGSPTFNSGAVFAQKES    141 - 210
PGAPPAFASPPDPWGRLHRSPLTFPAWVRPPEAARTPGSDKERPVERREPSITKEEKDRDLPFSRPQLRV    211 - 280
SPATPKARAGEEGPRPTKESVRVKEERKEEAAAAAAAAAAAAAAAAAAATGPQGLHLLFERPRPPPFLGP    281 - 350
SPPDRCAGFLEPTWLAAPPRLARPPRFYEAGEELTGPGAVAAARLYGLEPAHPLLYSRLAPPPPPAAAPG    351 - 420
TPHLLSKTPPGALLGAPPPLVPAPRPSSPPRGPGPARADR                                  421 - 460
//

Text Mined References (15)

PMID Year Title