Property Summary

NCBI Gene PubMed Count 24
PubMed Score 3.16
PubTator Score 3.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.700 8.3e-03
atypical teratoid / rhabdoid tumor -1.400 7.0e-06
Breast cancer 3.700 2.2e-02
ependymoma -1.800 1.6e-02
glioblastoma -1.200 4.3e-04
lung carcinoma 1.600 4.3e-33
medulloblastoma, large-cell -1.200 1.8e-04
oligodendroglioma -1.600 1.5e-02
ovarian cancer 1.400 1.1e-02

Gene RIF (2)

AA Sequence

MAMHNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKN      1 - 70
SNSKNDRRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQLIEKREPGSGTESDTSPDFHNQENEPSQEDP     71 - 140
EDLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRHRIDLKLNKKPRADY                       141 - 191
//

Text Mined References (36)

PMID Year Title