Property Summary

NCBI Gene PubMed Count 23
Grant Count 2
Funding $53,728.5
PubMed Score 2.40
PubTator Score 3.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.700 0.008
ependymoma -1.800 0.016
oligodendroglioma -1.600 0.015
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.200 0.000
Breast cancer 3.700 0.022
lung carcinoma 1.600 0.000
ovarian cancer 1.400 0.011

Synonym

Accession Q9HAF1 B1AK64 Q4F967 Q7Z311 Q86WE3 MYST/Esa1-associated factor 6
Symbols EAF6
CENP-28
C1orf149
NY-SAR-91

Gene

 Grant Application (2)

Gene RIF (1)

PMID Text
24530230 present two more ESS with MEAF6/PHF1 detected by transcriptome sequencing (case 1) and RT-PCR (case 2), proving that this fusion is recurrent in ESS

AA Sequence

MAMHNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKN      1 - 70
SNSKNDRRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQLIEKREPGSGTESDTSPDFHNQENEPSQEDP     71 - 140
EDLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRHRIDLKLNKKPRADY                       141 - 191
//

Text Mined References (34)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24530230 2014 MEAF6/PHF1 is a recurrent gene fusion in endometrial stromal sarcoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22761769 2012 Novel fusion of MYST/Esa1-associated factor 6 and PHF1 in endometrial stromal sarcoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20813266 2010 The protein composition of mitotic chromosomes determined using multiclassifier combinatorial proteomics.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...