Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.03
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
subependymal giant cell astrocytoma 2287 3.1e-02

Expression

  Differential Expression (1)

Disease log2 FC p
subependymal giant cell astrocytoma 1.105 3.1e-02

Synonym

Accession Q9HAC8 D3DR57 Q53HI3
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDA      1 - 70
LKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLEHTEEESLEPPE     71 - 140
PPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQ    141 - 210
KDFVIQVIINQPPPPQD                                                         211 - 227
//

Text Mined References (13)

PMID Year Title