Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.03
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
subependymal giant cell astrocytoma 2,287

Expression

  Differential Expression (1)

Disease log2 FC p
subependymal giant cell astrocytoma 1.105 0.031

Gene RIF (2)

PMID Text
25382750 Establish UBTD1 as a regulator of cellular senescence that mediates p53 function, and provide insights into the mechanism of Mdm2 inhibition that impacts p53 dynamics during cellular senescence and tumourigenesis.
24211586 Biochemical characterization of recombinant UBTD1 and UBE2D demonstrated that the two proteins form a stable, stoichiometric complex that can be purified to near homogeneity.

AA Sequence

MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDA      1 - 70
LKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLEHTEEESLEPPE     71 - 140
PPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQ    141 - 210
KDFVIQVIINQPPPPQD                                                         211 - 227
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25382750 2015 UBTD1 induces cellular senescence through an UBTD1-Mdm2/p53 positive feedback loop.
24211586 2014 The UbL protein UBTD1 stably interacts with the UBE2D family of E2 ubiquitin conjugating enzymes.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
More...