Property Summary

NCBI Gene PubMed Count 17
Grant Count 7
R01 Count 2
Funding $1,132,617.2
PubMed Score 58.67
PubTator Score 13.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
nephrosclerosis -1.232 0.006
osteosarcoma 1.416 0.000
adrenocortical carcinoma -1.773 0.000
non-small cell lung cancer 1.353 0.000
lung cancer 1.400 0.001
ulcerative colitis -1.800 0.000
pancreatic cancer 1.200 0.001
Breast cancer 1.400 0.004
invasive ductal carcinoma 1.040 0.000
ovarian cancer 1.100 0.042

Gene RIF (7)

PMID Text
23893049 C7orf10 encodes succinate-hydroxymethylglutarate CoA-transferase, which is the enzyme that converts glutarate to glutaryl-CoA
22277967 Identified as a candidate disease gene for OXPHOS disorders by next-generation sequencing
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18926513 Geneic mapping of GA3 to chromosome 7 and identification of mutations in c7orf10 are reported.

AA Sequence

MPSETHAMLATLARVAALRRTCLFSGRGGGRGLWTGRPQSDMNNIKPLEGVKILDLTRVLAGPFATMNLG      1 - 70
DLGAEVIKVERPGAGDDTRTWGPPFVGTESTYYLSVNRNKKSIAVNIKDPKGVKIIKELAAVCDVFVENY     71 - 140
VPGKLSAMGLGYEDIDEIAPHIIYCSITGYGQTGPISQRAGYDAVASAVSGLMHITGPENGDPVRPGVAM    141 - 210
TDLATGLYAYGAIMAGLIQKYKTGKGLFIDCNLLSSQVACLSHIAANYLIGQKEAKRWGTAHGSIVPYQA    211 - 280
FKTKDGYIVVGAGNNQQFATVCKILDLPELIDNSKYKTNHLRVHNRKELIKILSERFEEELTSKWLYLFE    281 - 350
GSGVPYGPINNMKNVFAEPQVLHNGLVMEMEHPTVGKISVPGPAVRYSKFKMSEARPPPLLGQHTTHILK    351 - 420
EVLRYDDRAIGELLSAGVVDQHETH                                                 421 - 445
//

Text Mined References (17)

PMID Year Title
23893049 2014 C7orf10 encodes succinate-hydroxymethylglutarate CoA-transferase, the enzyme that converts glutarate to glutaryl-CoA.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
22277967 2012 Molecular diagnosis of infantile mitochondrial disease with targeted next-generation sequencing.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19197348 2009 Genome-wide association studies in an isolated founder population from the Pacific Island of Kosrae.
18926513 2008 Genetic mapping of glutaric aciduria, type 3, to chromosome 7 and identification of mutations in c7orf10.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...