Property Summary

NCBI Gene PubMed Count 17
PubMed Score 64.29
PubTator Score 13.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active ulcerative colitis -1.320 1.2e-02
adrenocortical carcinoma -1.773 2.3e-06
Breast cancer 1.400 3.6e-03
invasive ductal carcinoma 1.040 1.1e-04
lung cancer 1.300 5.3e-03
nephrosclerosis -1.232 6.2e-03
non-small cell lung cancer 1.353 4.1e-11
osteosarcoma 1.416 3.4e-04
ovarian cancer 1.100 4.2e-02
pancreatic cancer 1.200 5.1e-04

Gene RIF (7)

AA Sequence

MPSETHAMLATLARVAALRRTCLFSGRGGGRGLWTGRPQSDMNNIKPLEGVKILDLTRVLAGPFATMNLG      1 - 70
DLGAEVIKVERPGAGDDTRTWGPPFVGTESTYYLSVNRNKKSIAVNIKDPKGVKIIKELAAVCDVFVENY     71 - 140
VPGKLSAMGLGYEDIDEIAPHIIYCSITGYGQTGPISQRAGYDAVASAVSGLMHITGPENGDPVRPGVAM    141 - 210
TDLATGLYAYGAIMAGLIQKYKTGKGLFIDCNLLSSQVACLSHIAANYLIGQKEAKRWGTAHGSIVPYQA    211 - 280
FKTKDGYIVVGAGNNQQFATVCKILDLPELIDNSKYKTNHLRVHNRKELIKILSERFEEELTSKWLYLFE    281 - 350
GSGVPYGPINNMKNVFAEPQVLHNGLVMEMEHPTVGKISVPGPAVRYSKFKMSEARPPPLLGQHTTHILK    351 - 420
EVLRYDDRAIGELLSAGVVDQHETH                                                 421 - 445
//

Text Mined References (17)

PMID Year Title