Property Summary

NCBI Gene PubMed Count 10
PubMed Score 353.98
PubTator Score 5.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.500 2.2e-02
oligodendroglioma -1.800 2.3e-02
osteosarcoma -1.663 5.7e-07
ovarian cancer 1.500 9.7e-04
subependymal giant cell astrocytoma 1.017 3.9e-02

Gene RIF (1)

AA Sequence

MAEMDPVAEFPQPPGAARWAEVMARFAARLGAQGRRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSA      1 - 70
EAFLAAGYGVLFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAEALRSYQEAAA     71 - 140
AGTFLAVEFTTLADYLHLLQAAAQALNPLGPSAMFYLAAAVSDFYVPVSEMPEHKIQSSGGPLQITMKMV    141 - 210
PKLLSPLVKDWAPKAFIISFKLETDPAIVINRARKALEIYQHQVVVANILESRQSFVFIVTKDSETKLLL    211 - 280
SEEEIEKGVEIEEKIVDNLQSRHTAFIGDRN                                           281 - 311
//

Text Mined References (14)

PMID Year Title