Property Summary

NCBI Gene PubMed Count 21
PubMed Score 23.18
PubTator Score 17.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 1.200 8.6e-04
Astrocytoma, Pilocytic 1.100 4.8e-04
atypical teratoid / rhabdoid tumor 1.900 7.7e-08
Breast cancer 1.400 2.9e-14
breast carcinoma 1.400 7.6e-15
chronic rhinosinusitis 1.058 6.8e-03
glioblastoma 1.100 6.7e-05
intraductal papillary-mucinous carcinoma... 1.100 4.0e-04
invasive ductal carcinoma 1.500 1.3e-03
lung adenocarcinoma 1.500 9.4e-12
lung cancer 1.100 1.3e-02
medulloblastoma, large-cell 1.900 1.4e-06
Multiple myeloma 1.571 9.4e-05
non-small cell lung cancer 1.321 4.5e-16
ovarian cancer 1.100 3.3e-04
pancreatic ductal adenocarcinoma liver m... 1.315 4.0e-02
primitive neuroectodermal tumor 1.200 5.2e-04
psoriasis 1.600 4.8e-04

Gene RIF (9)

AA Sequence

MAAPTPARPVLTHLLVALFGMGSWAAVNGIWVELPVVVKELPEGWSLPSYVSVLVALGNLGLLVVTLWRR      1 - 70
LAPGKDEQVPIRVVQVLGMVGTALLASLWHHVAPVAGQLHSVAFLALAFVLALACCASNVTFLPFLSHLP     71 - 140
PRFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPINGTPGPPLDFLERFPASTFFWALTALLVASAAA    141 - 210
FQGLLLLLPPPPSVPTGELGSGLQVGAPGAEEEVEESSPLQEPPSQAAGTTPGPDPKAYQLLSARSACLL    211 - 280
GLLAATNALTNGVLPAVQSFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLGGLSLLGVFCG    281 - 350
GYLMALAVLSPCPPLVGTSAGVVLVVLSWVLCLGVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSLLGA    351 - 420
VAMFPPTSIYHVFHSRKDCADPCDS                                                 421 - 445
//

Text Mined References (24)

PMID Year Title