Knowledge Summary

Patent

No data available

Synonym

Accession Q9HAA7
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MLFGIRILVNTPSPLVTGLHHYNPSIHRDQGECANQWRKGPGSAHLAGLAGRCSLINTPSPLVTGLQRYN      1 - 70
PSMDRAQGMCASLEEEAGLCKPLWAWWELQSHKHSQTSHHRAAGLQSQHAPGSGRVRITGGKV            71 - 133
//

Text Mined References (1)

PMID Year Title