Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
non-small cell lung cancer -1.305 0.000
lung adenocarcinoma -3.300 0.000

Gene RIF (1)

PMID Text
22632162 Both HIV-1 Tat 47-59 and FITC-labeled Tat 47-59 peptides downregulate gene expression of coiled-coil domain containing 48 (CCDC48) in U-937 macrophages

AA Sequence

MEPVSTGAEAGMEGAGGDPYRRPARRTQWLLSALAHHYGLDRGVENEIVVLATGLDQYLQEVFHHLDCRG      1 - 70
AGRLPRADFRALCAVLGLRAEGATTAGQAAGDGNSRDVTPGDAAAELATDGDSDTDEEARLALRAEPPEL     71 - 140
TFRQFHARLCGYFGTRAGPRLPRGALSEHIETQIRLRRPRRRRRPPCAPGPDSGPDCERVARLEEENSSL    141 - 210
RELVEDLRAALQSSDARCLALQVGLWKSQASTHEMGHGGPEAAVRELRQAQGALAAAEARAGRLRRGQAE    211 - 280
VRRRAEEARQVVLRSLHRVRELEALAQQVPGLQRWVRRLEAELQRYRSEDSQLPTPQLANPEPGDKSNEP    281 - 350
EDAGTRDPDPTPEGAWQSDSSSGSRALDEVDEQLFRSVEGQAASDEEEVEEERWQEEKKTPAAEAKTLLA    351 - 420
RLSSCRGRCDDQTAEKLMTYFGHFGGANHAHTLGELEACIAMLVEQLRTQGCGGRTLGTSEEEAELQQKV    421 - 490
EENEHLRLELQMVETERVRLSLLEEKLVDVLQLLQRLRDLNISKRALGKILLSTLDAFRDPTHEGRPSPA    491 - 560
AILDALHQALAACQLLRRQPSAPASAAAALTNPLLVSC                                    561 - 598
//

Text Mined References (4)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.