Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.70
PubTator Score 1.23

Knowledge Summary

Patent (700)

Expression

  Differential Expression (8)

Disease log2 FC p
cystic fibrosis -1.087 9.3e-05
intraductal papillary-mucinous adenoma (... -1.200 4.6e-04
malignant mesothelioma 1.100 3.3e-05
non-small cell lung cancer -1.139 1.0e-16
osteosarcoma 1.523 1.1e-03
ovarian cancer -1.200 1.9e-07
pituitary cancer 1.100 3.8e-04
psoriasis 1.200 3.7e-03

Gene RIF (3)

AA Sequence

MAALIAENFRFLSLFFKSKDVMIFNGLVALGTVGSQELFSVVAFHCPCSPARNYLYGLAAIGVPALVLFI      1 - 70
IGIILNNHTWNLVAECQHRRTKNCSAAPTFLLLSSILGRAAVAPVTWSVISLLRGEAYVCALSEFVDPSS     71 - 140
LTAREEHFPSAHATEILARFPCKENPDNLSDFREEVSRRLRYESQLFGWLLIGVVAILVFLTKCLKHYCS    141 - 210
PLSYRQEAYWAQYRANEDQLFQRTAEVHSRVLAANNVRRFFGFVALNKDDEELIANFPVEGTQPRPQWNA    211 - 280
ITGVYLYRENQGLPLYSRLHKWAQGLAGNGAAPDNVEMALLPS                               281 - 323
//

Text Mined References (11)

PMID Year Title