Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.52
PubTator Score 11.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 2.4e-05
ovarian cancer 8520 3.0e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 3.0

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.200 3.0e-04
psoriasis 2.100 2.4e-05

Synonym

Accession Q9HA64 Q969F4 Q9H0U7
Symbols FN3KL

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARRMFEGEMASLTAILKTNTVKV      1 - 70
PKPIKVLDAPGGGSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKKLGEMRLKEAGTVGRGGGQEERPFV     71 - 140
ARFGFDVVTCCGYLPQVNDWQEDWVVFYARQRIQPQMDMVEKESGDREALQLWSALQLKIPDLFRDLEII    141 - 210
PALLHGDLWGGNVAEDSSGPVIFDPASFYGHSEYELAIAGMFGGFSSSFYSAYHGKIPKAPGFEKRLQLY    211 - 280
QLFHYLNHWNHFGSGYRGSSLNIMRNLVK                                             281 - 309
//

Text Mined References (18)

PMID Year Title