Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.52
PubTator Score 7.08

Knowledge Summary

Patent (650)

TINX Plot

  Disease (2)

Disease Target Count P-value
pancreatic ductal adenocarcinoma liver metastasis 1962 6.2e-03
Disease Target Count Z-score Confidence
Estrogen excess 4 3.826 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.034 6.2e-03

Gene RIF (2)

AA Sequence

MASAGGEDCESPAPEADRPHQRPFLIGVSGGTASGKSTVCEKIMELLGQNEVEQRQRKVVILSQDRFYKV      1 - 70
LTAEQKAKALKGQYNFDHPDAFDNDLMHRTLKNIVEGKTVEVPTYDFVTHSRLPETTVVYPADVVLFEGI     71 - 140
LVFYSQEIRDMFHLRLFVDTDSDVRLSRRVLRDVRRGRDLEQILTQYTTFVKPAFEEFCLPTKKYADVII    141 - 210
PRGVDNMVAINLIVQHIQDILNGDICKWHRGGSNGRSYKRTFSEPGDHPGMLTSGKRSHLESSSRPH       211 - 277
//

Text Mined References (15)

PMID Year Title