Property Summary

NCBI Gene PubMed Count 23
Grant Count 4
R01 Count 4
Funding $466,493.25
PubMed Score 19.03
PubTator Score 18.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Synonym

Accession Q9HA38 B3KVA6 D3DNR1 Q96A21
Symbols WIG1
WIG-1
PAG608

Gene

PANTHER Protein Class (2)

Gene RIF (12)

PMID Text
25379706 expression of the p53 target Wig-1 is associated with HPV status and patient survival in cervical carcinoma
24469038 Results suggest a role of Wig-1 as a survival factor that directs the p53 stress response toward cell cycle arrest rather than apoptosis through the regulation of FAS and 14-3-3sigma mRNA levels.
23158102 PSF and MATR3 are cellular host factors that bind viral RNA and promote Rev activity.
23085987 The data indicated a novel role for Wig1 in RNA-induced silencing complex target accessibility, which is a key step in RNA-mediated gene silencing. Fine tuning of p21 levels by Wig1 was essential for the prevention of cellular senescence.
22513872 Wig-1 knockdown causes a dramatic inhibition of N-Myc expression and triggers differentiation in neuroblastoma cells carrying amplified N-Myc.
21559779 WIG-1 might be involved in the zinc-induced cell cycle arrest and apoptosis of human esophageal squamous cell carcinoma cells
21050045 WIG-1 might be a novel modifier in esophageal carcinogenesis, and the WIG-1 MAb should be useful in further study of the mechanism in WIG-1-related physiological reactions.
20962082 The cellular distribution of the nuclear matrix protein matrin 3 is altered by novel phosphorylation induced by the alphaherpesvirus US3 kinase family.
19805223 the p53 target Wig-1 is a previously undescribed AU-rich element-regulating protein that acts as a positive feedback regulator of p53, with implications both for the steady-state levels of p53 and for the p53 stress response
19127773 Data demonstrated a direct interaction between Dicer and Wig-1 and both may play a common role in dsRNA-related gene regulation.
More...

AA Sequence

MILLQHAVLPPPKQPSPSPPMSVATRSTGTLQLPPQKPFGQEASLPLAGEEELSKGGEQDCALEELCKPL      1 - 70
YCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSCPPPARMSNVVEPAATPVVPVPPQMGSFKPGGRV     71 - 140
ILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAEAQSNSFSESSELGQRRARKEGNEFKMMPNRR    141 - 210
NMYTVQNNSAGPYFNPRSRQRIPRDLAMCVTPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYR    211 - 280
NEMENLGYV                                                                 281 - 289
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25379706 2014 Expression of the p53 target Wig-1 is associated with HPV status and patient survival in cervical carcinoma.
24469038 2014 Wig-1 regulates cell cycle arrest and cell death through the p53 targets FAS and 14-3-3?.
23726511 2013 Genome-wide association study identifies new susceptibility loci for posttraumatic stress disorder.
23158102 2013 HIV-1 pre-mRNA commitment to Rev mediated export through PSF and Matrin 3.
23085987 2012 Wig1 prevents cellular senescence by regulating p21 mRNA decay through control of RISC recruitment.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22513872 2012 Wig-1, a novel regulator of N-Myc mRNA and N-Myc-driven tumor growth.
21559779 2011 Zinc induces cell cycle arrest and apoptosis by upregulation of WIG-1 in esophageal squamous cancer cell line EC109.
21050045 2010 Preparation of a novel monoclonal antibody specific for WIG-1 and detection of its expression pattern in human esophageal carcinoma.
More...