Property Summary

NCBI Gene PubMed Count 25
PubMed Score 19.45
PubTator Score 18.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
active ulcerative colitis 1.036 3.7e-02
acute myeloid leukemia 1.800 8.4e-03
acute quadriplegic myopathy 1.350 8.2e-05
adrenocortical adenoma 1.004 1.2e-02
Astrocytoma, Pilocytic 1.500 5.2e-04
atypical teratoid / rhabdoid tumor -1.200 1.4e-03
Breast cancer -1.400 1.6e-14
cystic fibrosis -1.100 9.5e-03
diabetes mellitus -1.100 3.4e-03
group 3 medulloblastoma -2.300 1.9e-04
Hydrolethalus syndrome 1.178 3.9e-02
juvenile dermatomyositis 1.277 6.7e-09
lung carcinoma 1.200 7.4e-16
malignant mesothelioma -2.000 1.2e-07
medulloblastoma, large-cell -1.100 1.1e-02
non primary Sjogren syndrome sicca -1.100 1.9e-02
osteosarcoma 1.436 7.1e-04
ovarian cancer -2.800 3.3e-10
pancreatic ductal adenocarcinoma liver m... 1.217 5.9e-03
Pick disease 1.900 2.5e-06
progressive supranuclear palsy 1.100 2.3e-02
psoriasis -2.300 1.3e-04
tuberculosis 1.100 3.6e-05

Gene RIF (14)

AA Sequence

MILLQHAVLPPPKQPSPSPPMSVATRSTGTLQLPPQKPFGQEASLPLAGEEELSKGGEQDCALEELCKPL      1 - 70
YCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSCPPPARMSNVVEPAATPVVPVPPQMGSFKPGGRV     71 - 140
ILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAEAQSNSFSESSELGQRRARKEGNEFKMMPNRR    141 - 210
NMYTVQNNSAGPYFNPRSRQRIPRDLAMCVTPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYR    211 - 280
NEMENLGYV                                                                 281 - 289
//

Text Mined References (27)

PMID Year Title