Property Summary

NCBI Gene PubMed Count 111
PubMed Score 277.01
PubTator Score 210.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 2.9e-02
cystic fibrosis -1.008 5.3e-05
diabetes mellitus 1.400 1.1e-03
malignant mesothelioma 7.000 3.3e-10
ovarian cancer -1.400 3.1e-07

 GWAS Trait (1)

Gene RIF (97)

AA Sequence

MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPV      1 - 70
DVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCY     71 - 140
NCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN     141 - 209
//

Text Mined References (113)

PMID Year Title