Property Summary

NCBI Gene PubMed Count 96
Grant Count 132
R01 Count 53
Funding $15,043,307.79
PubMed Score 244.24
PubTator Score 210.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 7.000 0.000
cystic fibrosis -1.008 0.000
diabetes mellitus 1.400 0.001
atypical teratoid/rhabdoid tumor 1.100 0.029
ovarian cancer -1.400 0.000

Synonym

Accession Q9H9Z2 Lin-28A
Symbols CSDD1
LIN28
LIN-28
ZCCHC1
lin-28A

Gene

PDB

2CQF   2LI8  

 GWAS Trait (1)

Gene RIF (83)

PMID Text
26945970 The role of Lin28 in cancer and immunity. [Review]
26714839 Our findings suggest that Lin28 plays a key role in the acquisition of resistance to AR-targeted therapies by prostate cancer cells and establish the importance of Lin28 in prostate cancer progression.
26675483 Erythroid-Specific Expression of LIN28A Is Sufficient for Robust Gamma-Globin Gene and Protein Expression in Adult Erythroblasts.
26583126 high LIN28 expressing ovarian cancer cells secrete exosomes that can be taken up by nontumor cells and cause changes in gene expression and cell behavior associated with tumor development. IGROV1
26494358 data document the expression profiles of the Lin28/let-7 system in rat testis along postnatal/pubertal maturation, and their perturbation in models of pubertal and hormonal manipulation
26149387 LIN28 may regulate splicing and gene expression programs that drive breast cancer subtype phenotypes.
26045559 Incubation of a embryonal carcinoma cell line with N-methyl-mesoporphyrin IX reduces its stem cell traits. In particular it decreases OCT4, HMGA1, CCNB1, CDK4, and Lin28A protein, decreases sphere formation, and inhibits colony formation.
25956904 detected aberrant expression of LIN28A and/or LIN28B in 38% of a large series of human CRC samples (n = 595), where LIN28 expression levels were associated with invasive tumor growth
25748578 Intraocular medulloepitheliomas and embryonal tumors with multilayered rosettes of the brain both display LIN28A positivity. Only the latter, however, display amplification of the 19q13.42 locus involving C19MC
25638158 Data implicate LIN28/RAS/MAP kinase as key drivers of tumorigenesis atypical teratoid rhabdoid tumors.
More...

AA Sequence

MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPV      1 - 70
DVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCY     71 - 140
NCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN     141 - 209
//

Text Mined References (98)

PMID Year Title
26945970 2016 RNA-binding protein Lin28 in cancer and immunity.
26714839 2016 Lin28 induces resistance to anti-androgens via promotion of AR splice variant generation.
26675483 2015 Erythroid-Specific Expression of LIN28A Is Sufficient for Robust Gamma-Globin Gene and Protein Expression in Adult Erythroblasts.
26583126 2015 High LIN28A Expressing Ovarian Cancer Cells Secrete Exosomes That Induce Invasion and Migration in HEK293 Cells.
26494358 2015 Testicular expression of the Lin28/let-7 system: Hormonal regulation and changes during postnatal maturation and after manipulations of puberty.
26149387 2015 LIN28A Modulates Splicing and Gene Expression Programs in Breast Cancer Cells.
26045559 2015 An RNA-binding Protein, Lin28, Recognizes and Remodels G-quartets in the MicroRNAs (miRNAs) and mRNAs It Regulates.
25956904 2015 LIN28 cooperates with WNT signaling to drive invasive intestinal and colorectal adenocarcinoma in mice and humans.
25748578 2015 Intraocular Medulloepitheliomas and Embryonal Tumors With Multilayered Rosettes of the Brain: Comparative Roles of LIN28A and C19MC.
25638158 2015 Disrupting LIN28 in atypical teratoid rhabdoid tumors reveals the importance of the mitogen activated protein kinase pathway as a therapeutic target.
More...