Property Summary

NCBI Gene PubMed Count 24
PubMed Score 5.77
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.011 6.1e-05
astrocytic glioma 1.500 1.0e-02
atypical teratoid/rhabdoid tumor 1.100 3.7e-06
ependymoma 1.500 7.2e-03
gastric cancer 1.100 1.1e-03
glioblastoma 1.200 5.0e-04
group 3 medulloblastoma 1.500 1.2e-03
hepatocellular carcinoma 1.100 2.0e-05
medulloblastoma, large-cell 1.300 7.1e-05
Multiple myeloma -1.384 1.0e-02
nasopharyngeal carcinoma 1.200 1.1e-03
non-small cell lung cancer 1.057 4.8e-15
oligodendroglioma 1.500 3.9e-03
osteosarcoma 1.581 2.3e-07
ovarian cancer -2.600 1.1e-05
pancreatic cancer 1.100 1.5e-03
pancreatic carcinoma 1.100 1.5e-03
pancreatic ductal adenocarcinoma liver m... 1.371 1.1e-02
pediatric high grade glioma 1.100 3.7e-06
Pick disease 1.400 2.9e-07
primitive neuroectodermal tumor 1.200 7.2e-05

Gene RIF (4)

AA Sequence

MDPGSRWRNLPSGPSLKHLTDPSYGIPREQQKAALQELTRAHVESFNYAVHEGLGLAVQAIPPFEFAFKD      1 - 70
ERISFTILDAVISPPTVPKGTICKEANVYPAECRGRRSTYRGKLTADINWAVNGISKGIIKQFLGYVPIM     71 - 140
VKSKLCNLRNLPPQALIEHHEEAEEMGGYFIINGIEKVIRMLIMPRRNFPIAMIRPKWKTRGPGYTQYGV    141 - 210
SMHCVREEHSAVNMNLHYLENGTVMLNFIYRKELFFLPLGFALKALVSFSDYQIFQELIKGKEDDSFLRN    211 - 280
SVSQMLRIVMEEGCSTQKQVLNYLGECFRVKLNVPDWYPNEQAAEFLFNQCICIHLKSNTEKFYMLCLMT    281 - 350
RKLFALAKGECMEDNPDSLVNQEVLTPGQLFLMFLKEKLEGWLVSIKIAFDKKAQKTSVSMNTDNLMRIF    351 - 420
TMGIDLTKPFEYLFATGNLRSKTGLGLLQDSGLCVVADKLNFIRYLSHFRCVHRGADFAKMRTTTVRRLL    421 - 490
PESWGFLCPVHTPDGEPCGLMNHLTAVCEVVTQFVYTASIPALLCNLGVTPIDGAPHRSYSECYPVLLDG    491 - 560
VMVGWVDKDLAPGIADSLRHFKVLREKRIPPWMEVVLIPMTGKPSLYPGLFLFTTPCRLVRPVQNLALGK    561 - 630
EELIGTMEQIFMNVAIFEDEVFAGVTTHQELFPHSLLSVIANFIPFSDHNQSPRNMYQCQMGKQTMGFPL    631 - 700
LTYQDRSDNKLYRLQTPQSPLVRPSMYDYYDMDNYPIGTNAIVAVISYTGYDMEDAMIVNKASWERGFAH    701 - 770
GSVYKSEFIDLSEKIKQGDSSLVFGIKPGDPRVLQKLDDDGLPFIGAKLQYGDPYYSYLNLNTGESFVMY    771 - 840
YKSKENCVVDNIKVCSNDTGSGKFKCVCITMRVPRNPTIGDKFASRHGQKGILSRLWPAEDMPFTESGMV    841 - 910
PDILFNPHGFPSRMTIGMLIESMAGKSAALHGLCHDATPFIFSEENSALEYFGEMLKAAGYNFYGTERLY    911 - 980
SGISGLELEADIFIGVVYYQRLRHMVSDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGT    981 - 1050
SFLLHDRLFNCSDRSVAHVCVKCGSLLSPLLEKPPPSWSAMRNRKYNCTLCSRSDTIDTVSVPYVFRYFV   1051 - 1120
AELAAMNIKVKLDVV                                                          1121 - 1135
//

Text Mined References (28)

PMID Year Title