Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.6e-04

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.100 1.6e-04

Synonym

Accession Q9H9Y4 Q96HG4 Q9NUE1 Q9NW30
Symbols ATPBD1B

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAGAAPTTAFGQAVIGPPGSGKTTYCLGMSEFLRALGRRVAVVNLDPANEGLPYECAVDVGELVGLGDVM      1 - 70
DALRLGPNGGLLYCMEYLEANLDWLRAKLDPLRGHYFLFDCPGQVELCTHHGALRSIFSQMAQWDLRLTA     71 - 140
VHLVDSHYCTDPAKFISVLCTSLATMLHVELPHINLLSKMDLIEHYGKLAFNLDYYTEVLDLSYLLDHLA    141 - 210
SDPFFRHYRQLNEKLVQLIEDYSLVSFIPLNIQDKESIQRVLQAVDKANGYCFRAQEQRSLEAMMSAAMG    211 - 280
ADFHFSSTLGIQEKYLAPSNQSVEQEAMQL                                            281 - 310
//

Text Mined References (9)

PMID Year Title