Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.13
PubTator Score 6.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.3e-04
Multiple myeloma 1332 6.3e-04
group 3 medulloblastoma 4104 1.6e-03
osteosarcoma 7950 1.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Ankylosis 28 3.818 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.200 1.6e-03
Multiple myeloma 1.823 6.3e-04
osteosarcoma 1.100 1.7e-03
ovarian cancer -1.300 1.3e-04

AA Sequence

MAKAGDKSSSSGKKSLKRKAAAEELQEAAGAGDGATENGVQPPKAAAFPPGFSISEIKNKQRRHLMFTRW      1 - 70
KQQQRKEKLAAKKKLKKEREALGDKAPPKPVPKTIDNQRVYDETTVDPNDEEVAYDEATDEFASYFNKQT     71 - 140
SPKILITTSDRPHGRTVRLCEQLSTVIPNSHVYYRRGLALKKIIPQCIARDFTDLIVINEDRKTPNGLIL    141 - 210
SHLPNGPTAHFKMSSVRLRKEIKRRGKDPTEHIPEIILNNFTTRLGHSIGRMFASLFPHNPQFIGRQVAT    211 - 280
FHNQRDYIFFRFHRYIFRSEKKVGIQELGPRFTLKLRSLQKGTFDSKYGEYEWVHKPREMDTSRRKFHL     281 - 349
//

Text Mined References (11)

PMID Year Title