Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.13
PubTator Score 6.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Multiple myeloma 1328 6.31677653146796E-4
group 3 medulloblastoma 2254 0.00162860873393815
osteosarcoma 7933 0.00165507170909666
ovarian cancer 8492 0.0132574535221676
Disease Target Count Z-score Confidence
Ankylosis 25 3.793 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.823 0.001
osteosarcoma 1.100 0.002
group 3 medulloblastoma 1.200 0.002
ovarian cancer 1.400 0.013

Synonym

Accession Q9H9Y2 Q5VSK7 Q6AHX1 Q8WXZ8
Symbols BXDC5

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

AA Sequence

MAKAGDKSSSSGKKSLKRKAAAEELQEAAGAGDGATENGVQPPKAAAFPPGFSISEIKNKQRRHLMFTRW      1 - 70
KQQQRKEKLAAKKKLKKEREALGDKAPPKPVPKTIDNQRVYDETTVDPNDEEVAYDEATDEFASYFNKQT     71 - 140
SPKILITTSDRPHGRTVRLCEQLSTVIPNSHVYYRRGLALKKIIPQCIARDFTDLIVINEDRKTPNGLIL    141 - 210
SHLPNGPTAHFKMSSVRLRKEIKRRGKDPTEHIPEIILNNFTTRLGHSIGRMFASLFPHNPQFIGRQVAT    211 - 280
FHNQRDYIFFRFHRYIFRSEKKVGIQELGPRFTLKLRSLQKGTFDSKYGEYEWVHKPREMDTSRRKFHL     281 - 349
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
11864606 2002 The sigma(70)-like motif: a eukaryotic RNA binding domain unique to a superfamily of proteins required for ribosome biogenesis.
More...