Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.63
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.1e-07
psoriasis 6694 5.0e-05

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.400 1.1e-07
psoriasis 1.600 5.0e-05

AA Sequence

MRAGPEPQALAGQKRGALRLLVPRLVLTVSAPAEVRRRVLRPVLSWMDRETRALADSHFRGLGVDVPGVG      1 - 70
QAPGRVAFVSEPGAFSYADFVRGFLLPNLPCVFSSAFTQGWGSRRRWVTPAGRPDFDHLLRTYGDVVVPV     71 - 140
ANCGVQEYNSNPKEHMTLRDYITYWKEYIQAGYSSPRGCLYLKDWHLCRDFPVEDVFTLPVYFSSDWLNE    141 - 210
FWDALDVDDYRFVYAGPAGSWSPFHADIFRSFSWSVNVCGRKKWLLFPPGQEEALRDRHGNLPYDVTSPA    211 - 280
LCDTHLHPRNQLAGPPLEITQEAGEMVFVPSGWHHQVHNLDDTISINHNWVNGFNLANMWRFLQQELCAV    281 - 350
QEEVSEWRDSMPDWHHHCQVIMRSCSGINFEEFYHFLKVIAEKRLLVLREAAAEDGAGLGFEQAAFDVGR    351 - 420
ITEVLASLVAHPDFQRVDTSAFSPQPKELLQQLREAVDAAAAP                               421 - 463
//

Text Mined References (6)

PMID Year Title