Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.57
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
ovarian cancer 8,484
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.600 0.000
ovarian cancer 1.400 0.000

Synonym

Accession Q9H9V9 Q5TBZ1 Q5TBZ6 Q9H970
Symbols

Gene

PANTHER Protein Class (1)

 Compartment GO Term (1)

AA Sequence

MRAGPEPQALAGQKRGALRLLVPRLVLTVSAPAEVRRRVLRPVLSWMDRETRALADSHFRGLGVDVPGVG      1 - 70
QAPGRVAFVSEPGAFSYADFVRGFLLPNLPCVFSSAFTQGWGSRRRWVTPAGRPDFDHLLRTYGDVVVPV     71 - 140
ANCGVQEYNSNPKEHMTLRDYITYWKEYIQAGYSSPRGCLYLKDWHLCRDFPVEDVFTLPVYFSSDWLNE    141 - 210
FWDALDVDDYRFVYAGPAGSWSPFHADIFRSFSWSVNVCGRKKWLLFPPGQEEALRDRHGNLPYDVTSPA    211 - 280
LCDTHLHPRNQLAGPPLEITQEAGEMVFVPSGWHHQVHNLDDTISINHNWVNGFNLANMWRFLQQELCAV    281 - 350
QEEVSEWRDSMPDWHHHCQVIMRSCSGINFEEFYHFLKVIAEKRLLVLREAAAEDGAGLGFEQAAFDVGR    351 - 420
ITEVLASLVAHPDFQRVDTSAFSPQPKELLQQLREAVDAAAAP                               421 - 463
//

Text Mined References (6)

PMID Year Title
24486019 2014 Optimal translational termination requires C4 lysyl hydroxylation of eRF1.
24360279 2013 Brd4 and JMJD6-associated anti-pause enhancers in regulation of transcriptional pause release.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.