Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.23
PubTator Score 3.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 4.11534493397915E-11
lung cancer 4473 3.93788419570454E-4
psoriasis 6685 5.12643560231833E-4
non diabetic and post-ischemic heart failure 200 8.76425777097902E-4
cutaneous lupus erythematosus 1056 0.00346783222671976
type II diabetes mellitus and post-ischemic heart failure 89 0.019951243402733

Expression

  Differential Expression (6)

Synonym

Accession Q9H9V4 Q52LK3
Symbols

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

AA Sequence

MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFISKLRNQAQSE      1 - 70
RYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIASP     71 - 140
SEATQNIGILLDELV                                                           141 - 155
//

Text Mined References (9)

PMID Year Title
16778963 2006 [Cloning, expression and subcellular localization of a novel human gene-RNF122].
16751333 2006 Cell-based screening and validation of human novel genes associated with cell viability.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
8744354 1996 Does this have a familiar RING?
7601449 1995 Isolation of 115 human chromosome 8-specific expressed-sequence tags by exon amplification.