Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.01
PubTator Score 3.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 3.5e-03
lung cancer -1.400 3.9e-04
lung carcinoma -1.700 4.1e-11
non diabetic and post-ischemic heart fai... -1.400 8.8e-04
psoriasis 1.500 5.1e-04
type II diabetes mellitus and post-ische... -1.100 2.0e-02

AA Sequence

MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFISKLRNQAQSE      1 - 70
RYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIASP     71 - 140
SEATQNIGILLDELV                                                           141 - 155
//

Text Mined References (9)

PMID Year Title