Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.23
PubTator Score 3.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Synonym

Accession Q9H9V4 Q52LK3
Symbols

Gene

AA Sequence

MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFISKLRNQAQSE      1 - 70
RYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIASP     71 - 140
SEATQNIGILLDELV                                                           141 - 155
//

Text Mined References (9)

PMID Year Title
16778963 2006 [Cloning, expression and subcellular localization of a novel human gene-RNF122].
16751333 2006 Cell-based screening and validation of human novel genes associated with cell viability.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
8744354 1996 Does this have a familiar RING?
7601449 1995 Isolation of 115 human chromosome 8-specific expressed-sequence tags by exon amplification.