Property Summary

NCBI Gene PubMed Count 25
Grant Count 13
R01 Count 7
Funding $1,365,320.75
PubMed Score 50.26
PubTator Score 19.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
gastric cancer 1.100 0.001
osteosarcoma -2.077 0.000
ovarian cancer -1.800 0.000

Gene RIF (10)

PMID Text
25148870 Promoter hypermethylation is an important mechanism of the transcriptional inactivation of ELP3 in invasive ductal breast carcinoma.
24769394 Regulation of G6PD acetylation by SIRT2 and KAT9 modulates NADPH homeostasis and cell survival during oxidative stress.
22216241 data suggest that hElp3 can regulate the transcription of HSP70 gene, and the HAT domain of hElp3 is essential for this function
20877300 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20626565 The results of this study uncover a novel role for Elp3 in the regulation of synaptic bouton expansion during neurogenesis that may be linked with a requirement for sleep.
20036197 Elp3 promotes the acetylation of alpha-tubulin in microtubules in neurological disorders.
19429107 ELP3 localises to mitochondria in HeLa cells, actin-like filaments, and actin-rich sites at the edges of spreading cells. This suggests that ELP3 and the ELONGATOR complex may play a role in mitochondrial function, actin organisation, and cell motility.
18996918 Allelic variants of ELP3 were associated with amyotrophic lateral sclerosis in three populations comprising 1483 people.
18996918 Observational study of gene-disease association. (HuGE Navigator)
17558451 We used hELP3 antisense oligonucl. to knock down hELP3 gene. The results showed that reduction of hELP3 mRNA and protein caused a suppression of HSP70-2 and histone H3 hypoacetylation.

AA Sequence

MRQKRKGDLSPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDIIAAVPPQYRK      1 - 70
VLMPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRA     71 - 140
RYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNNIYEAVKYSER    141 - 210
SLTKCIGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFK    211 - 280
VVAHMMPDLPNVGLERDIEQFTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLVELVA    281 - 350
RILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGIQCRDVRTREVGIQEIHHKVRPYQV    351 - 420
ELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFELGGGVSIVRELHVYGSVVPVSSRDPT    421 - 490
KFQHQGFGMLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKIGYRLQGPYMVKMLK                 491 - 547
//

Text Mined References (35)

PMID Year Title
25148870 2014 Promoter hypermethylation may be an important mechanism of the transcriptional inactivation of ARRDC3, GATA5, and ELP3 in invasive ductal breast carcinoma.
24769394 2014 Regulation of G6PD acetylation by SIRT2 and KAT9 modulates NADPH homeostasis and cell survival during oxidative stress.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
22854966 2012 DERP6 (ELP5) and C3ORF75 (ELP6) regulate tumorigenicity and migration of melanoma cells as subunits of Elongator.
22216241 2011 hElp3 directly modulates the expression of HSP70 gene in HeLa cells via HAT activity.
22002106 2012 Systematic analysis of protein pools, isoforms, and modifications affecting turnover and subcellular localization.
21269460 2011 Initial characterization of the human central proteome.
20877300 2012 Genome-wide association study of increasing suicidal ideation during antidepressant treatment in the GENDEP project.
20626565 2010 The histone acetyltransferase Elp3 plays in active role in the control of synaptic bouton expansion and sleep in Drosophila.
20036197 2010 Elongator - an emerging role in neurological disorders.
More...