Property Summary

NCBI Gene PubMed Count 26
PubMed Score 53.48
PubTator Score 19.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
osteosarcoma 7950 1.4e-06
ovarian cancer 8520 1.1e-05
gastric cancer 459 7.1e-04
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
Disease Target Count Z-score Confidence
Riley-Day syndrome 11 5.545 2.8

Expression

  Differential Expression (3)

Disease log2 FC p
gastric cancer 1.100 7.1e-04
osteosarcoma -2.077 1.4e-06
ovarian cancer -1.800 1.1e-05

Protein-protein Interaction (7)

Gene RIF (11)

AA Sequence

MRQKRKGDLSPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDIIAAVPPQYRK      1 - 70
VLMPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRA     71 - 140
RYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALSGHTSNNIYEAVKYSER    141 - 210
SLTKCIGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFK    211 - 280
VVAHMMPDLPNVGLERDIEQFTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLVELVA    281 - 350
RILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGIQCRDVRTREVGIQEIHHKVRPYQV    351 - 420
ELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFELGGGVSIVRELHVYGSVVPVSSRDPT    421 - 490
KFQHQGFGMLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKIGYRLQGPYMVKMLK                 491 - 547
//

Text Mined References (36)

PMID Year Title