Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.33
PubTator Score 3.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma -1.873 5.4e-11
adult high grade glioma -2.100 8.0e-04
atypical teratoid / rhabdoid tumor 1.200 1.7e-04
Breast cancer -1.200 4.1e-08
breast carcinoma -1.100 7.1e-06
colon cancer -1.300 4.2e-02
ependymoma 1.200 4.8e-02
glioblastoma -1.400 1.5e-03
interstitial cystitis -1.400 2.7e-03
intraductal papillary-mucinous adenoma (... -1.300 1.9e-02
intraductal papillary-mucinous carcinoma... -1.300 7.5e-04
lung adenocarcinoma -1.300 3.3e-13
lung cancer -1.600 5.8e-04
lung carcinoma -1.200 2.8e-08
medulloblastoma -1.400 2.2e-03
medulloblastoma, large-cell -3.000 4.7e-07
non-small cell lung cancer -1.532 3.4e-21
osteosarcoma 1.985 2.7e-02
ovarian cancer -2.600 7.8e-12
pituitary cancer 1.200 7.6e-05
psoriasis -1.100 3.1e-03
spina bifida -1.657 3.6e-02

Synonym

Accession Q9H9S4 Q5TAW6 Q6WG71 Q96FG1 Q9BZ33
Symbols MO2L
MO25-BETA
bA103J18.3

Gene

PANTHER Protein Class (2)

PDB

3ZHP  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (2)

Protein-protein Interaction (5)

Gene RIF (5)

AA Sequence

MKKMPLFSKSHKNPAEIVKILKDNLAILEKQDKKTDKASEEVSKSLQAMKEILCGTNEKEPPTEAVAQLA      1 - 70
QELYSSGLLVTLIADLQLIDFEGKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIAL     71 - 140
RCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIF    141 - 210
EDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVF    211 - 280
VASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRDLKKTAP                 281 - 337
//

Text Mined References (19)

PMID Year Title