Property Summary

NCBI Gene PubMed Count 16
Grant Count 5
Funding $152,128.81
PubMed Score 3.07
PubTator Score 3.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
posterior fossa group B ependymoma 2.200 0.000
psoriasis -1.400 0.000
osteosarcoma 1.985 0.027
glioblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma -1.400 0.002
medulloblastoma, large-cell -3.000 0.000
adrenocortical carcinoma -3.018 0.000
non-small cell lung cancer -2.828 0.000
intraductal papillary-mucinous adenoma (... -1.300 0.019
intraductal papillary-mucinous carcinoma... -1.900 0.003
colon cancer -1.300 0.042
lung cancer -1.600 0.001
breast carcinoma -1.100 0.000
interstitial cystitis -2.100 0.000
lung adenocarcinoma -2.300 0.000
adult high grade glioma -2.100 0.001
Breast cancer -2.300 0.000
lung carcinoma -1.200 0.000
spina bifida -2.128 0.042
ovarian cancer -2.600 0.000
pituitary cancer 2.400 0.000

Synonym

Accession Q9H9S4 Q5TAW6 Q6WG71 Q96FG1 Q9BZ33
Symbols MO2L
MO25-BETA
bA103J18.3

Gene

PANTHER Protein Class (2)

PDB

3ZHP  

Gene RIF (5)

PMID Text
26306467 Frameshift Mutations of CAB39L are associated with Gastric and Colorectal Cancers.
23135622 In conclusion, our current results provide new evidence that MLAA-34 may be a novel anti-apoptotic factor in vitro, and the data presented here show a strong correlation between anti-apoptosis with the upregulation of MLAA-34.
21240483 our data indicate that MLAA-34 may be used as a prognostic marker for treatment decision-making in acute monocytic leukemia
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18592235 It was proposed that a splice variant MLAA-34 of CAB39L associated with acute monocytic leukemia. MLAA-34 was identified and characterized. Identification and functional characterization of the novel acute monocytic leukemia associated antigen MLAA-34

AA Sequence

MKKMPLFSKSHKNPAEIVKILKDNLAILEKQDKKTDKASEEVSKSLQAMKEILCGTNEKEPPTEAVAQLA      1 - 70
QELYSSGLLVTLIADLQLIDFEGKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIAL     71 - 140
RCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVADFLEQNYDTIF    141 - 210
EDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVF    211 - 280
VASPHKTQPIVEILLKNQPKLIEFLSSFQKERTDDEQFADEKNYLIKQIRDLKKTAP                 281 - 337
//

Text Mined References (18)

PMID Year Title
26306467 2016 Frameshift Mutations of CAB39L, an Activator of LKB1 Tumor Suppressor, in Gastric and Colorectal Cancers.
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23135622 2013 The expression and functional characterization associated with cell apoptosis and proteomic analysis of the novel gene MLAA-34 in U937 cells.
21269460 2011 Initial characterization of the human central proteome.
21240483 2011 Quantitative assessment of MLAA-34 expression in diagnosis and prognosis of acute monocytic leukemia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18592235 2009 Identification and functional characterization of the novel acute monocytic leukemia associated antigen MLAA-34.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...