Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.24
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 2.39401951783426E-32
glioblastoma multiforme 347 4.13535136183486E-21
Breast cancer 3099 5.29214830867804E-16
posterior fossa group B ependymoma 1530 1.30962157803967E-7
osteosarcoma 7933 3.13549547885625E-5
adult high grade glioma 2148 9.99485930133934E-5
Pick disease 1893 1.15608460097733E-4
lung cancer 4473 7.19641321106864E-4
group 3 medulloblastoma 2254 0.00304712853846363
invasive ductal carcinoma 2950 0.0106887556371687
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0224010726903622

Expression

  Differential Expression (11)

Disease log2 FC p
posterior fossa group B ependymoma -1.400 0.000
glioblastoma multiforme -1.200 0.000
osteosarcoma -1.760 0.000
pancreatic ductal adenocarcinoma liver m... -1.089 0.022
lung cancer 1.600 0.001
adult high grade glioma -1.200 0.000
group 3 medulloblastoma 1.300 0.003
lung carcinoma 1.400 0.000
Pick disease -1.500 0.000
Breast cancer 1.500 0.000
invasive ductal carcinoma 1.400 0.011

Synonym

Gene

PANTHER Protein Class (1)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILA      1 - 70
SNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDP     71 - 140
AEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFE    141 - 210
GAVIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYSSYP    211 - 280
IKLFYTSNIPIILQSALVSNLYVISQMLSVRFSGNFLVNLLGQWADVSGGGPARSYPVGGLCYYLSPPES    281 - 350
MGAIFEDPVHVVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTA    351 - 420
AAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQAEVGGMGALFF                  421 - 476
//

Text Mined References (10)

PMID Year Title
18480044 2008 Control of translocation through the Sec61 translocon by nascent polypeptide structure within the ribosome.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11217851 2001 Functional annotation of a full-length mouse cDNA collection.
10212142 1999 The Sec61 complex is located in both the ER and the ER-Golgi intermediate compartment.
9631292 1998 The role of assembly in insulin's biosynthesis.
9565615 1998 Calnexin and other factors that alter translocation affect the rapid binding of ubiquitin to apoB in the Sec61 complex.